Record in detail
General Info
- lamp_id:L01A002892
- Name:TACA2_TACTR
- FullName:Tachystatin-A2
- Source:Tachypleus tridentatus
- Mass:5061.8 Da
- Sequence Length:44 aa
- Isoelectric Point:9.1
- Activity:Antibacterial, Antifungal
- Sequence
YSRCQLQGFNCVVRSYGLPTIPCCRGLTCRSYFPGSTYGRCQRY - Function:Exhibits stronger antimicrobial activity against the Gram-positive bacteria (S.aureus (IC(50) is 4.2 ug/ml)) and fungi (C.albicans (IC(50) is 3.0 ug/ml) and P.pastoris (IC(50) is 0.5 ug/ml)) than Gram-negative bacteria (E.coli (IC(50) is 25 ug/ml)). Binds to chitin (8.4 uM are required to obtain 50% of binding). Does not cause hemolysis on sheep erythrocytes. Has no blocking activity on the P-type calcium channel.
Cross-Linking
- Cross-linking
- 1 Database:APD 154
- 2 Database:APD 1008
- 3 Database:CAMP CAMPSQ880
- 4 Database:DBAASP 1849
- 5 Database:dbAMP dbAMP_12289
- 6 Database:DRAMP DRAMP02942
- 7 Database:SATPdb satpdb26676
- 8 Database:Uniprot Q9U8X3
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L12A08087| From 24 To 67 E-value: 5e-21 Score: 91.7
YSRCQLQGFNCVVRSYGLPTIPCCRGLTCRSYFPGSTYGRCQRY - 2. L03A000161 From 24 To 67 E-value: 9e-21 Score: 90.5
YSRCQLQGFNCVVRSYGLPTIPCCRGLTCRSYFPGSTYGRCQRF - 3. L01A002892 From 1 To 44 E-value: 2e-20 Score: 89.4
YSRCQLQGFNCVVRSYGLPTIPCCRGLTCRSYFPGSTYGRCQRY - 4. L01A002992 From 1 To 44 E-value: 4e-20 Score: 88.2
YSRCQLQGFNCVVRSYGLPTIPCCRGLTCRSYFPGSTYGRCQRF - 5. L13A023384 From 1 To 39 E-value: 8e-16 Score: 74.3
YSRCQLQGFNCVVRSYGLPTIPCCRG----SYFPGSTYGRCQR
Activity
- Antibacterial Activities
- 1 Target: S.aureus IC50: 4.2 μg/ml (0.829744 μM)
- 2 Target: C.albicans IC50: 3 μg/ml (0.592675 μM)
- 3 Target: P.pastoris IC50: 0.5 μg/ml (0.0987791 μM)
- 4 Target: E.coli IC50: 25 μg/ml (4.93895 μM)
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Iwanaga S.,Hirata M.,Nagayama R.,Omotezako M.,Osaki T.,
- Title:Horseshoe crab hemocyte-derived antimicrobial polypeptides, tachystatins, with sequence similarity to spider neurotoxins.
- Journal:J. Biol. Chem., 1999, 274, 26172-26178 [MEDLINE:99403058]
- [2] Demura M.,Kumaki Y.,Osaki T.,Kawabata S.,Fujitani N.,
- Title:Structure of the antimicrobial peptide tachystatin A.
- Journal:J. Biol. Chem., 2002, 277, 23651-23657 [PubMed:11959852]
Comments
- Comments
No comments found on LAMP database