Record in detail


General Info

  • lamp_id:L01A002901
  • Name:AMP1_MESCR
  • FullName:Antimicrobial peptide 1
  • Source:Mesembryanthemum crystallinum
  • Mass:4287.9 Da
  • Sequence Length:38 aa
  • Isoelectric Point:9.16
  • Activity:Antibacterial, Antifungal
  • Sequence
        AKCIKNGKGCREDQGPPFCCSGFCYRQVGWARGYCKNR
  • Function:Possesses antifungal and antibacterial activity (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000099    From 27 To 66 E-value: 1e-17 Score: 80.1
        AKCIKNGKGCREDQGPPFCFTCSGFCYRQVGWARGYCKNR
  • 2. L01A002901    From 1 To 38 E-value: 2e-17 Score: 79.7
        AKCIKNGKGCREDQGPPFCCSGFCYRQVGWARGYCKNR
  • 3. L03A000073    From 24 To 61 E-value: 0.000000001 Score: 53.9
        AQCIGNGGRCNENVGPPYCCSGFCLRQPGQGYGYCKNR
  • 4. L01A000208    From 1 To 37 E-value: 0.00000001 Score: 50.4
        QCIGNGGRCNENVGPPYCCSGFCLRQPGQGYGYCKNR
  • 5. L11A001642    From 2 To 37 E-value: 0.00000002 Score: 49.7
        CIGNGGRCNENVGPPYCCSGFCLRQPGQGYGYCKNR

Structure

  •   Domains
  •   1  Name:Antimicrobial_C6_CS    Interpro Link:IPR013006
  •   2  Name:Gurmarin/antifun_pep    Interpro Link:IPR009101
  •   3  Name:Gurmarin/antimicrobial_peptd    Interpro Link:IPR024206
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: