Record in detail


General Info

  • lamp_id:L01A002903
  • Name:ANDP_DROME
  • FullName:Andropin
  • Source:Drosophila melanogaster
  • Mass:3750.4 Da
  • Sequence Length:34 aa
  • Isoelectric Point:7.55
  • Activity:Antibacterial
  • Sequence
        VFIDILDKVENAIHNAAQVGIGFAKPFEKLINPK
  • Function:Male-specific peptide with moderate activity against Gram-positive bacteria.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000193    From 24 To 57 E-value: 0.00000000000001 Score: 70.5
        VFIDILDKVENAIHNAAQVGIGFAKPFEKLINPK
  • 2. L01A002903    From 1 To 34 E-value: 0.00000000000003 Score: 68.9
        VFIDILDKVENAIHNAAQVGIGFAKPFEKLINPK
  • 3. L01A002387    From 1 To 34 E-value: 0.0000000002 Score: 56.6
        VFIDILDKMENAIHKAAQAGIGIAKPIEKMILPK
  • 4. L03A000194    From 24 To 57 E-value: 0.0000000005 Score: 54.7
        VFIDILDKMENAIHKAAQAGIGLAKPIENMILPK
  • 5. L01A002905    From 1 To 34 E-value: 0.0000000006 Score: 54.7
        VFIDILDKMENAIHKAAQAGIGLAKPIENMILPK

Structure

  •   Domains
  •   1  Name:Cecropin    Interpro Link:IPR000875
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Escherichia coli D21  MIC:  525.06 μg/ml  (140.001 μM)  
  •   2  Target:  Enterobacter cloacae b312  MIC:  1125.12 μg/ml  (300 μM)  
  •   3  Target:  Pseudomonas aeruginosa OT97  MIC:  1125.12 μg/ml  (300 μM)  
  •   4  Target:  Serratia marcescens Db 11  MIC:  476.3 μg/ml  (127 μM)  
  •   5  Target:  Serratia marcescens Db 1140  MIC:  476.3 μg/ml  (127 μM)  
  •   6  Target:  Bacillus megatherium Bml1  MIC:  41.25 μg/ml  (10.9988 μM)  
  •   7  Target:  Bacillus subtilis Bs11  MIC:  63.76 μg/ml  (17.0009 μM)  
  •   8  Target:  Micrococcus luteus MIll  MIC:  75.01 μg/ml  (20.0005 μM)  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Hultmark D.,Engstroem A.,Kimbrell D.A.,Kylsten P.,Samakovlis C.,
  •   Title:The andropin gene and its product, a male-specific antibacterial peptide in Drosophila melanogaster.
  •   Journal:EMBO J., 1991, 10, 163-169  [MEDLINE:91114699]
  •   [2]  Wang L.,Clark A.G.,
  •   Title:Molecular population genetics of Drosophila immune system genes.
  •   Journal:Genetics, 1997, 147, 713-724  [MEDLINE:97476321]
  •   [3]  Aguade M.,Ramos-Onsins S.,
  •   Title:Molecular evolution of the Cecropin multigene family in Drosophila: functional genes vs pseudogenes.
  •   Journal:Genetics, 1998, 150, 157-171  [MEDLINE:98393576]
  •   [4]  Gocayne J.D.,Evans C.A.,Holt R.A.,Celniker S.E.,Adams M.D.,
  •   Title:The genome sequence of Drosophila melanogaster.
  •   Journal:Science, 2000, 287, 2185-2195  [MEDLINE:20196006]
  •   [5]  Campbell K.S.,Matthews B.B.,Mungall C.J.,Crosby M.A.,Misra S.,
  •   Title:Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.
  •   Journal:Genome Biol., 2002, 3, 0-0  [MEDLINE:22426069]
  •   [6]  Chigusa S.I.,Sawai H.,Kasahara K.,Date-Ito A.,
  •   Title:Rapid evolution of the male-specific antibacterial protein andropin gene in Drosophila.
  •   Journal:J. Mol. Evol., 2002, 54, 665-670  [MEDLINE:21962106]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: