Record in detail


General Info

  • lamp_id:L01A002905
  • Name:ANDP_DROSE
  • FullName:Andropin
  • Source:Drosophila sechellia
  • Mass:3703.4 Da
  • Sequence Length:34 aa
  • Isoelectric Point:7.55
  • Activity:Antibacterial
  • Sequence
        VFIDILDKMENAIHKAAQAGIGLAKPIENMILPK
  • Function:Male-specific peptide with moderate activity against Gram-positive bacteria.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000194    From 24 To 57 E-value: 0.00000000000001 Score: 70.1
        VFIDILDKMENAIHKAAQAGIGLAKPIENMILPK
  • 2. L01A002905    From 1 To 34 E-value: 0.00000000000003 Score: 68.9
        VFIDILDKMENAIHKAAQAGIGLAKPIENMILPK
  • 3. L01A002906    From 1 To 34 E-value: 0.00000000000005 Score: 68.2
        VFIDILDKMENAIHKAAQAGIGIAKPIENMILPK
  • 4. L03A000192    From 24 To 57 E-value: 0.00000000000006 Score: 68.2
        VFIDILDKMENAIHKAAQAGIGIAKPIENMILPK
  • 5. L01A002387    From 1 To 34 E-value: 0.0000000000004 Score: 65.5
        VFIDILDKMENAIHKAAQAGIGIAKPIEKMILPK

Structure

  •   Domains
  •   1  Name:Cecropin    Interpro Link:IPR000875
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Aguade M.,Ramos-Onsins S.,
  •   Title:Molecular evolution of the Cecropin multigene family in Drosophila: functional genes vs pseudogenes.
  •   Journal:Genetics, 1998, 150, 157-171  [MEDLINE:98393576]
  •   [2]  Chigusa S.I.,Sawai H.,Kasahara K.,Date-Ito A.,
  •   Title:Rapid evolution of the male-specific antibacterial protein andropin gene in Drosophila.
  •   Journal:J. Mol. Evol., 2002, 54, 665-670  [MEDLINE:21962106]
  •   [3]  
  •   Title:Evolution of genes and genomes on the Drosophila phylogeny.
  •   Journal:Nature, 2007, 450, 203-218  [PubMed:17994087]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: