Record in detail
General Info
- lamp_id:L01A002907
- Name:ANDP_DROTE
- FullName:Andropin
- Source:Drosophila teissieri
- Mass:4433.1 Da
- Sequence Length:40 aa
- Isoelectric Point:10.11
- Activity:Antibacterial
- Sequence
FINLLDKVEDALHTGAQAGFKLIRPVERGATPKKSEKPEK - Function:Male-specific peptide with moderate activity against Gram-positive bacteria.
Cross-Linking
- Cross-linking
- 1 Database:CAMP CAMPSQ1556
- 2 Database:dbAMP dbAMP_01803
- 3 Database:DRAMP DRAMP03107
- 4 Database:SATPdb satpdb21215
- 5 Database:Uniprot Q8WSV1
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L03A000191 From 23 To 62 E-value: 6e-19 Score: 84.3
FINLLDKVEDALHTGAQAGFKLIRPVERGATPKKSEKPEK - 2. L01A002907 From 1 To 40 E-value: 2e-18 Score: 82.8
FINLLDKVEDALHTGAQAGFKLIRPVERGATPKKSEKPEK - 3. L03A000190 From 25 To 58 E-value: 0.00000008 Score: 47.4
FVDVLDNVETALHNAAKAGFKLIKPIEKMIMPSK - 4. L01A002908 From 2 To 34 E-value: 0.0000002 Score: 46.2
FVDVLDNVETALHNAAKAGFKLIKPIEKLIMPK - 5. L01A002905 From 2 To 34 E-value: 0.000008 Score: 40.8
FIDILDKMENAIHKAAQAGIGLAKPIENMILPK
Structure
- Domains
No domains found on LAMP database
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Chigusa S.I.,Sawai H.,Kasahara K.,Date-Ito A.,
- Title:Rapid evolution of the male-specific antibacterial protein andropin gene in Drosophila.
- Journal:J. Mol. Evol., 2002, 54, 665-670 [MEDLINE:21962106]
Comments
- Comments
No comments found on LAMP database