Record in detail
General Info
- lamp_id:L01A002908
- Name:ANDP_DROYA
- FullName:Andropin
- Source:Drosophila yakuba
- Mass:3777.5 Da
- Sequence Length:34 aa
- Isoelectric Point:9.32
- Activity:Antibacterial
- Sequence
IFVDVLDNVETALHNAAKAGFKLIKPIEKLIMPK - Function:Male-specific peptide with moderate activity against Gram-positive bacteria.
Cross-Linking
- Cross-linking
- 1 Database:CAMP CAMPSQ1557
- 2 Database:dbAMP dbAMP_04591
- 3 Database:DRAMP DRAMP03108
- 4 Database:Uniprot Q8WPA1
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L01A002908 From 1 To 34 E-value: 0.00000000000003 Score: 68.9
IFVDVLDNVETALHNAAKAGFKLIKPIEKLIMPK - 2. L03A000190 From 24 To 56 E-value: 0.00000000000006 Score: 68.2
IFVDVLDNVETALHNAAKAGFKLIKPIEKMIMP - 3. L01A002387 From 1 To 34 E-value: 0.0000001 Score: 47.4
VFIDILDKMENAIHKAAQAGIGIAKPIEKMILPK - 4. L03A000189 From 24 To 56 E-value: 0.0000002 Score: 46.6
LFVDIIDNVENAIHKAAKTGIGMVKPIENIFIP - 5. L03A000193 From 24 To 57 E-value: 0.0000002 Score: 46.6
VFIDILDKVENAIHNAAQVGIGFAKPFEKLINPK
Structure
- Domains
No domains found on LAMP database
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Chigusa S.I.,Sawai H.,Kasahara K.,Date-Ito A.,
- Title:Rapid evolution of the male-specific antibacterial protein andropin gene in Drosophila.
- Journal:J. Mol. Evol., 2002, 54, 665-670 [MEDLINE:21962106]
- [2]
- Title:Evolution of genes and genomes on the Drosophila phylogeny.
- Journal:Nature, 2007, 450, 203-218 [PubMed:17994087]
Comments
- Comments
No comments found on LAMP database