Record in detail


General Info

  • lamp_id:L01A002914
  • Name:SPHE1_APTPA
  • FullName:Spheniscin-1
  • Source:Aptenodytes patagonicus
  • Mass:4488.3 Da
  • Sequence Length:38 aa
  • Isoelectric Point:11.96
  • Activity:Antibacterial, Antifungal
  • Sequence
        SFGLCRLRRGFCAHGRCRFPSIPIGRCSRFVQCCRRVW
  • Function:Has antifungal activity and antibacterial activity against Gram-positive and Gram-negative bacteria. Involved in the process of food preservation in the stomach during the incubation fast. May also be present during infection.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002914    From 1 To 38 E-value: 3e-16 Score: 75.5
        SFGLCRLRRGFCAHGRCRFPSIPIGRCSRFVQCCRRVW
  • 2. L02A000732    From 1 To 38 E-value: 0.000000000000001 Score: 73.2
        SFGLCRLRRGSCAHGRCRFPSIPIGRCSRFVQCCRRVW
  • 3. L01A002915    From 1 To 38 E-value: 0.000000000000002 Score: 72.8
        SFGLCRLRRGFCARGRCRFPSIPIGRCSRFVQCCRRVW
  • 4. L03A000258    From 25 To 58 E-value: 0.0000009 Score: 43.9
        CRIRGGFCRVGSCRFPHIAIGKCATFISCCGRAY
  • 5. L05ADEF299    From 25 To 58 E-value: 0.0000009 Score: 43.9
        CRIRGGFCRVGSCRFPHIAIGKCATFISCCGRAY

Structure

  •   Domains
  •   1  Name:Defensin_beta-typ    Interpro Link:IPR001855
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Le Bohec C.,Sabatier L.,Froget G.,Le Maho Y.,Thouzeau C.,
  •   Title:Spheniscins, avian beta-defensins in preserved stomach contents of the king penguin, Aptenodytes patagonicus.
  •   Journal:J. Biol. Chem., 2003, 278, 51053-51058  [PubMed:14525994]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: