Record in detail
General Info
- lamp_id:L01A002916
- Name:DEFB1_CHLAE
- FullName:Beta-defensin 1
- Source:Chlorocebus aethiops
- Mass:4000.6 Da
- Sequence Length:36 aa
- Isoelectric Point:8.61
- Activity:Antimicrobial
- Sequence
DHYNCVRSGGQCLYSACPIYTKIQGTCYHGKAKCCK - Function:Has bactericidal activity (By similarity).
Cross-Linking
- Cross-linking
- 1 Database:CAMP CAMPSQ1563
- 2 Database:dbAMP dbAMP_01054
- 3 Database:DRAMP DRAMP02611
- 4 Database:Uniprot Q95J24
- 5 Database:DEF DEF86
- 6 Database:DEF DEF108
- 7 Database:DEF DEF115
- 8 Database:DEF DEF118
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L03A000296 From 33 To 68 E-value: 4e-17 Score: 78.6
DHYNCVRSGGQCLYSACPIYTKIQGTCYHGKAKCCK - 2. L03A000293 From 33 To 68 E-value: 4e-17 Score: 78.6
DHYNCVRSGGQCLYSACPIYTKIQGTCYHGKAKCCK - 3. L03A000295 From 33 To 68 E-value: 1e-16 Score: 77
DHYNCVRSGGQCLYSACPIYTRIQGTCYHGKAKCCK - 4. L05A0DEF88 From 11 To 46 E-value: 2e-16 Score: 76.3
DHYNCVRSGGQCLYSACPIYTKIQGTCYHGKAKCCK - 5. L01A002916 From 1 To 36 E-value: 3e-16 Score: 75.5
DHYNCVRSGGQCLYSACPIYTKIQGTCYHGKAKCCK
Structure
- Domains
- 1 Name:Defensin_beta-typ Interpro Link:IPR001855
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Spano A.,Cervella P.,Zuccon D.,Boniotto M.,Del Pero M.,
- Title:Beta-defensin 1 gene variability among non-human primates.
- Journal:Immunogenetics, 2002, 53, 907-913 [MEDLINE:21850507]
Comments
- Comments
No comments found on LAMP database