Record in detail


General Info

  • lamp_id:L01A002918
  • Name:Q865P6_HORSE
  • FullName:
  • Source:Equus caballus
  • Mass:3608.2 Da
  • Sequence Length:35 aa
  • Isoelectric Point:8.64
  • Activity:Antimicrobial
  • Sequence
        SFSCSQNGGFCISPKCLPGSKQIGTCILPGSKCCR
  • Function:null

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000254    From 28 To 62 E-value: 0.000000000000004 Score: 71.6
        SFSCSQNGGFCISPKCLPGSKQIGTCILPGSKCCR
  • 2. L05ADEF309    From 8 To 42 E-value: 0.00000000000001 Score: 70.5
        SFSCSQNGGFCISPKCLPGSKQIGTCILPGSKCCR
  • 3. L01A002918    From 1 To 35 E-value: 0.00000000000002 Score: 69.7
        SFSCSQNGGFCISPKCLPGSKQIGTCILPGSKCCR
  • 4. L01A002533    From 2 To 36 E-value: 0.000000000004 Score: 62
        SVTCSKNGGFCISPKCLPGSKQIGTCSLPGSKCCK
  • 5. L01A002509    From 2 To 36 E-value: 0.00000000006 Score: 58.2
        SVTCSKNGGFCISPKCPPGMKQIGTCGLPGSKCCR

Structure

  •   Domains
  •   1  Name:Defensin_beta-typ    Interpro Link:IPR001855
  •   2  Name:Defensin_beta/neutrophil    Interpro Link:IPR006080
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Blecha F.,Sang Y.,Davis E.G.,
  •   Title:Equine beta-defensin-1: full-length cDNA sequence and tissue expression.
  •   Journal:Vet. Immunol. Immunopathol., 2004, 99, 127-132  [PubMed:15113660]
  •   [2]  Kuiper H.,Regenhard P.,Philipp U.,Paul S.,Looft C.,
  •   Title:Sequence analysis of a 212 kb defensin gene cluster on ECA 27q17.
  •   Journal:Gene, 2006, 376, 192-198  [PubMed:16723195]
  •   [3]  Gnerre S.,Zoli M.,Sigurdsson S.,Giulotto E.,Wade C.M.,
  •   Title:Genome sequence, comparative analysis, and population genetics of the domestic horse.
  •   Journal:Science, 2009, 326, 865-867  [PubMed:19892987]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: