Record in detail


General Info

  • lamp_id:L01A002920
  • Name:O97942_CAPHI
  • FullName:
  • Source:Capra hircus
  • Mass:4327.1 Da
  • Sequence Length:38 aa
  • Isoelectric Point:10.83
  • Activity:Antimicrobial
  • Sequence
        NHRSCYRNKGVCAPARCPRNMRQIGTCHGPPVKCCRKK
  • Function:null

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000260    From 27 To 64 E-value: 4e-18 Score: 81.6
        NHRSCYRNKGVCAPARCPRNMRQIGTCHGPPVKCCRKK
  • 2. L12A04055|    From 10 To 47 E-value: 2e-17 Score: 79.3
        NHRSCYRNKGVCAPARCPRNMRQIGTCHGPPVKCCRKK
  • 3. L01A002920    From 1 To 38 E-value: 4e-17 Score: 78.2
        NHRSCYRNKGVCAPARCPRNMRQIGTCHGPPVKCCRKK
  • 4. L01A001367    From 1 To 36 E-value: 4e-16 Score: 75.1
        NHRSCYRNKGVCAPARCPRNMRQIGTCHGPPVKCCR
  • 5. L12A04736|    From 26 To 63 E-value: 0.0000000000001 Score: 66.6
        SRRSCHRNKGVCALTRCPRNMRQIGTCFGPPVKCCRKK

Structure

  •   Domains
  •   1  Name:Defensin_beta-typ    Interpro Link:IPR001855
  •   2  Name:Defensin_beta/neutrophil    Interpro Link:IPR006080
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Brogden K.,Shamova O.,Liu L.,Nguyen T.,Zhao C.,
  •   Title:Differential expression of caprine beta-defensins in digestive and respiratory tissues.
  •   Journal:Infect. Immun., 1999, 67, 6221-6224  [MEDLINE:20002622]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: