Record in detail


General Info

  • lamp_id:L01A002928
  • Name:DEF1_STOCA
  • FullName:Defensin-1
  • Source:Stomoxys calcitrans
  • Mass:4736.6 Da
  • Sequence Length:46 aa
  • Isoelectric Point:7.21
  • Activity:Antibacterial
  • Sequence
        AAKPMGITCDLLSLWKVGHAACAAHCLVLGDVGGYCTKEGLCVCKE
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000137    From 34 To 79 E-value: 4e-22 Score: 95.1
        AAKPMGITCDLLSLWKVGHAACAAHCLVLGDVGGYCTKEGLCVCKE
  • 2. L03A000138    From 34 To 79 E-value: 8e-22 Score: 94
        AAKPMGITCDLLSLWKVGHAACAAHCLVLGNVGGYCTKEGLCVCKE
  • 3. L01A002928    From 1 To 46 E-value: 2e-21 Score: 92.8
        AAKPMGITCDLLSLWKVGHAACAAHCLVLGDVGGYCTKEGLCVCKE
  • 4. L03A000132    From 59 To 97 E-value: 0.00000000004 Score: 58.5
        TCDLLSMWNVNHSACAAHCLLLGKSGGRCNDDAVCVCRK
  • 5. L02A001366    From 2 To 40 E-value: 0.00000000009 Score: 57.4
        TCDLLSMWNVNHSACAAHCLLLGKSGGRCNDDAVCVCRK

Structure

  •   Domains
  •   1  Name:Defensin_invertebrate/fungal    Interpro Link:IPR001542
  •   2  Name:Knot1    Interpro Link:IPR003614
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Lehane S.M.,Wu D.,Lehane M.J.,
  •   Title:Midgut-specific immune molecules are produced by the blood-sucking insect Stomoxys calcitrans.
  •   Journal:Proc. Natl. Acad. Sci. U.S.A., 1997, 94, 11502-11507  [MEDLINE:97470996]
  •   [2]  Lehane M.J.,Lehane S.M.,Hamilton J.V.,Munks R.J.L.,
  •   Title:Regulation of midgut defensin production in the blood-sucking insect Stomoxys calcitrans.
  •   Journal:Insect Mol. Biol., 2001, 10, 561-571  [MEDLINE:21901289]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: