Record in detail


General Info

  • lamp_id:L01A002933
  • Name:DEFB_AEDAE
  • FullName:Defensin-B
  • Source:Aedes aegypti
  • Mass:4078.6 Da
  • Sequence Length:40 aa
  • Isoelectric Point:8.12
  • Activity:Antibacterial
  • Sequence
        ATCDLLSGFGVGDSACAAHCIARGNRGGYCNSQKVCVCRN
  • Function:Antibacterial peptide mostly active against Gram-positive bacteria.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000168    From 59 To 98 E-value: 1e-18 Score: 83.6
        ATCDLLSGFGVGDSACAAHCIARGNRGGYCNSKKVCVCRN
  • 2. L01A002933    From 1 To 40 E-value: 5e-18 Score: 81.6
        ATCDLLSGFGVGDSACAAHCIARGNRGGYCNSQKVCVCRN
  • 3. L01A000505    From 1 To 40 E-value: 1e-17 Score: 80.1
        ATCDLLSGFGVGDSACAAHCIARGNRGGYCNSKKVCVCRN
  • 4. L03A000348    From 57 To 94 E-value: 2e-17 Score: 79.3
        ATCDLLSGFGVGDSACAAHCIARGNRGGYCNSKKVCVC
  • 5. L12A09253|    From 60 To 99 E-value: 3e-17 Score: 79
        ATCDLLSGFGVGDSACAAHCIARRNRGGYCNAKKVCVCRN

Structure

  •   Domains
  •   1  Name:Defensin_invertebrate/fungal    Interpro Link:IPR001542
  •   2  Name:Knot1    Interpro Link:IPR003614
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Hodgeman B.,Hetru C.,Charlet M.,Bulet P.,Lowenberger C.,
  •   Title:Insect immunity: isolation of three novel inducible antibacterial defensins from the vector mosquito, Aedes aegypti.
  •   Journal:Insect Biochem. Mol. Biol., 1995, 25, 867-873  [MEDLINE:95360030]
  •   [2]  Severson D.W.,Ferdig M.T.,Bulet P.,Smartt C.T.,Lowenberger C.A.,
  •   Title:Insect immunity: molecular cloning, expression, and characterization of cDNAs and genomic DNA encoding three isoforms of insect defensin in Aedes aegypti.
  •   Journal:Insect Mol. Biol., 1999, 8, 107-118  [MEDLINE:99124369]
  •   [3]  Kodira C.D.,Haas B.J.,Lawson D.,Wortman J.R.,Nene V.,
  •   Title:Genome sequence of Aedes aegypti, a major arbovirus vector.
  •   Journal:Science, 2007, 316, 1718-1723  [PubMed:17510324]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: