Record in detail


General Info

  • lamp_id:L01A002936
  • Name:Q86MY1_RHOPR
  • FullName:
  • Source:Rhodnius prolixus
  • Mass:3560.1 Da
  • Sequence Length:33 aa
  • Isoelectric Point:8.82
  • Activity:Antimicrobial
  • Sequence
        SKWFTPNHAGCAAHCIFLGNRGGRCVGTVCHCR
  • Function:null

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000128    From 61 To 93 E-value: 8e-16 Score: 74.3
        SKWFTPNHAGCAAHCIFLGNRGGRCVGTVCHCR
  • 2. L05ADEF445    From 10 To 42 E-value: 0.000000000000005 Score: 71.6
        SKWFTPNHAGCAAHCIFLGNRGGRCVGTVCHCR
  • 3. L01A002936    From 1 To 33 E-value: 0.00000000000001 Score: 70.5
        SKWFTPNHAGCAAHCIFLGNRGGRCVGTVCHCR
  • 4. L02A001370    From 10 To 42 E-value: 0.00000000000004 Score: 68.6
        SKWVTPNHAGCAAHCIFLGNRGGRCVGTVCHCR
  • 5. L05ADEF446    From 10 To 42 E-value: 0.0000000000003 Score: 65.5
        SKWFTPNHAACAAHCILLGNRGGHCVGTVCHCR

Structure

  •   Domains
  •   1  Name:Defensin_invertebrate/fungal    Interpro Link:IPR001542
  •   2  Name:Knot1    Interpro Link:IPR003614
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Lowenberger C.,Wolff M.,Ursic R.,Morales G.,Lopez L.,
  •   Title:Isolation and characterization of a novel insect defensin from Rhodnius prolixus, a vector of Chagas disease.
  •   Journal:Insect Biochem. Mol. Biol., 2003, 33, 439-447  [MEDLINE:22538373]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: