Record in detail


General Info

  • lamp_id:L01A002939
  • Name:DEFI_DROME
  • FullName:Defensin
  • Source:Drosophila melanogaster
  • Mass:4360 Da
  • Sequence Length:40 aa
  • Isoelectric Point:8.39
  • Activity:Antibacterial
  • Sequence
        ATCDLLSKWNWNHTACAGHCIAKGFKGGYCNDKAVCVCRN
  • Function:Responsible for the anti Gram-positive activity of immune hemolymph. Expressed in the absence of immune challenge during metamorphosis.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000136    From 53 To 92 E-value: 5e-20 Score: 88.2
        ATCDLLSKWNWNHTACAGHCIAKGFKGGYCNDKAVCVCRN
  • 2. L01A002939    From 1 To 40 E-value: 1e-18 Score: 83.6
        ATCDLLSKWNWNHTACAGHCIAKGFKGGYCNDKAVCVCRN
  • 3. L12A00606|    From 1 To 40 E-value: 0.000000000000005 Score: 71.6
        ATCDLASKWNWNHTLCAAHCIARRYRGGYCNSKAVCVCRN
  • 4. L12A00605|    From 1 To 40 E-value: 0.000000000003 Score: 62.4
        ATCDLASIFNVNHALCAAHCIARRYRGGYCNSKAVCVCRN
  • 5. L03A000167    From 55 To 94 E-value: 0.000000000004 Score: 61.6
        ATCDLLSGTGINHSACAAHCLLRGNRGGYCNGKAVCVCRN

Structure

  •   Domains
  •   1  Name:Defensin_invertebrate/fungal    Interpro Link:IPR001542
  •   2  Name:Knot1    Interpro Link:IPR003614
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Lanot R.,Bulet P.,Meister M.,Hoffmann D.,Dimarcq J.-L.,
  •   Title:Characterization and transcriptional profiles of a Drosophila gene encoding an insect defensin. A study in insect immunity.
  •   Journal:Eur. J. Biochem., 1994, 221, 201-209  [MEDLINE:94222062]
  •   [2]  Gocayne J.D.,Evans C.A.,Holt R.A.,Celniker S.E.,Adams M.D.,
  •   Title:The genome sequence of Drosophila melanogaster.
  •   Journal:Science, 2000, 287, 2185-2195  [MEDLINE:20196006]
  •   [3]  Campbell K.S.,Matthews B.B.,Mungall C.J.,Crosby M.A.,Misra S.,
  •   Title:Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.
  •   Journal:Genome Biol., 2002, 3, 0-0  [MEDLINE:22426069]
  •   [4]  Clark A.G.,Lazzaro B.P.,
  •   Title:Molecular population genetics of inducible antibacterial peptide genes in Drosophila melanogaster.
  •   Journal:Mol. Biol. Evol., 2003, 20, 914-923  [MEDLINE:22625906]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: