Record in detail


General Info

  • lamp_id:L01A002943
  • Name:DFAR1_MOUSE
  • FullName:Alpha-defensin-related sequence 1
  • Source:Mus musculus
  • Mass:6436.6 Da
  • Sequence Length:56 aa
  • Isoelectric Point:8.8
  • Activity:Antimicrobial
  • Sequence
        RFPWCRKCRVCQKCQVCQKCPVCPTCPQCPKQPLCEERQNKTAITTQAPNTQHKGC
  • Function:Apparent precursor of a secreted, cationic, proline- and cysteine-rich peptide that contains Cys-Pro-Xaa repeats. Unlike cryptdin, the proposed mature peptide region lacks the structural motif characteristic of defensins. It may have microbicidal activities.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002943    From 1 To 56 E-value: 3e-26 Score: 108
        RFPWCRKCRVCQKCQVCQKCPVCPTCPQCPKQPLCEERQNKTAITTQAPNTQHKGC
  • 2. L03A000157    From 60 To 84 E-value: 1.6 Score: 23.5
        RRARRCPPCPSCLSCPWCPRCLRCP
  • 3. L02A001631    From 21 To 33 E-value: 2 Score: 23.1
        CKRCPRCPTCPRC
  • 4. L01A002941    From 3 To 21 E-value: 4.6 Score: 21.9
        CPPCPRCSWCPRCPTCPRC
  • 5. L03A000155    From 78 To 87 E-value: 8.4 Score: 20.8
        CPRCPTCPRC

Structure

  •   Domains
  •   1  Name:Alpha-defensin    Interpro Link:IPR016327
  •   2  Name:Defensin_propep    Interpro Link:IPR002366
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Lauldi J.C.,Ouellette A.J.,
  •   Title:
  •   Journal:J. Biol. Chem., 1994, 269, 18702-18702  [MEDLINE:94308115]
  •   [2]  Lauldi J.C.,Ouellette A.J.,
  •   Title:A novel mouse gene family coding for cationic, cysteine-rich peptides. Regulation in small intestine and cells of myeloid origin.
  •   Journal:J. Biol. Chem., 1990, 265, 9831-9837  [MEDLINE:90277674]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: