Record in detail


General Info

  • lamp_id:L01A002945
  • Name:DIPD_PROTE
  • FullName:Diptericin-D
  • Source:Protophormia terraenovae
  • Mass:8692.6 Da
  • Sequence Length:82 aa
  • Isoelectric Point:9.46
  • Activity:Antibacterial
  • Sequence
        DEKPKLILPTPAPPNLPQLVGGGGGNRKDGFGVSVDAHQKVWTSDNGRHSIGVTPGYSQHLGGPYGNSRPDYRIGAGYSYNF
  • Function:Has activity against E.coli.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002945    From 1 To 82 E-value: 9.94922e-44 Score: 166
        DEKPKLILPTPAPPNLPQLVGGGGGNRKDGFGVSVDAHQKVWTSDNGRHSIGVTPGYSQHLGGPYGNSRPDYRIGAGYSYNF
  • 2. L01A002944    From 1 To 82 E-value: 2e-38 Score: 149
        DEKPKLILPTPAPPNLPQLVGGGGGNRKDGFGVSVDAHQKVWTSDNGGHSIGVSPGYSQHLPGPYGNSRPDYRIGAGYSYNF
  • 3. L12A01023|    From 1 To 80 E-value: 6e-37 Score: 144
        DEKPKLILPTPAPPNLPQLVGGGGGNRKDGFGVSVDAHQKVWTSDNGGHSIGVSPGYSQHLPGPYGNSRPDYRIGAGYSY
  • 4. L13A010017    From 1 To 50 E-value: 1e-23 Score: 100
        DEKPKLILPTPAPPNLPQLVGGGGGNRKDGFGVSVDAHQKVWTSDNGGHS
  • 5. L12A01007|    From 5 To 80 E-value: 7e-16 Score: 74.3
        MKPTPPPQYPLNLQGGGGGGSGDGFGFAVQGHQKVWTSDNGRHEIGLNGGYGQHLGGPYGNSEPSWKVGSTYTYRF

Structure

  •   Domains
  •   1  Name:Attacin_C    Interpro Link:IPR005521
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Hoffmann J.A.,Hoffmann D.,Dimarcq J.-L.,Essrich M.,Reichhart J.-M.,
  •   Title:Insect immunity. Isolation of cDNA clones corresponding to diptericin, an inducible antibacterial peptide from Phormia terranovae (Diptera). Transcriptional profiles during immunization.
  •   Journal:Eur. J. Biochem., 1989, 182, 423-427  [MEDLINE:89289731]
  •   [2]  Hoffmann J.A.,van Dorsselaer A.,Lambert J.,Hegy G.,Bulet P.,
  •   Title:Insect immunity. The inducible antibacterial peptide diptericin carries two O-glycans necessary for biological activity.
  •   Journal:Biochemistry, 1995, 34, 7394-7400  [MEDLINE:95298744]
  •   [3]  Bulet P.,van Dorsselaer A.,Lambert J.,Moniatte M.,Uttenweiler-Joseph S.,
  •   Title:A matrix-assisted laser desorption ionization time-of-flight mass spectrometry approach to identify the origin of the glycan heterogeneity of diptericin, an O-glycosylated antibacterial peptide from insects.
  •   Journal:Anal. Biochem., 1997, 247, 366-375  [MEDLINE:97320969]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: