Record in detail


General Info

  • lamp_id:L01A002950
  • Name:Q91X12_CAVPO
  • FullName:
  • Source:Cavia porcellus
  • Mass:5286.4 Da
  • Sequence Length:43 aa
  • Isoelectric Point:12.34
  • Activity:Antibacterial
  • Sequence
        GLRKKFRKTRKRIQKLGRKIGKTGRKVWKAWREYGQIPYPCRI
  • Function:null

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002950    From 1 To 43 E-value: 7e-19 Score: 84.3
        GLRKKFRKTRKRIQKLGRKIGKTGRKVWKAWREYGQIPYPCRI
  • 2. L12A06000|    From 1 To 42 E-value: 3e-18 Score: 82.4
        LRKKFRKTRKRIQKLGRKIGKTGRKVWKAWREYGQIPYPCRI
  • 3. L11A012334    From 5 To 24 E-value: 0.35 Score: 25.4
        KLGRKILRAWKKYGPIIVPI
  • 4. L11A012333    From 5 To 24 E-value: 0.38 Score: 25.4
        KLGRKILRAWKKYGPIIVPI
  • 5. L13A023640    From 5 To 24 E-value: 0.88 Score: 24.3
        SLGRKILRAWKKYGPIIVPI

Structure

  •   Domains
  •   1  Name:Cathelicidin    Interpro Link:IPR001894
  •   2  Name:Cathelicidin_CS    Interpro Link:IPR018216
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Yamashita T.,Nagaoka I.,Yomogida S.,
  •   Title:Purification of the 11- and 5-kDa antibacterial polypeptides from guinea pig neutrophils.
  •   Journal:Arch. Biochem. Biophys., 1996, 328, 219-226  [MEDLINE:96213869]
  •   [2]  Yamashita T.,Yomogida S.,Tsutsumi-Ishii Y.,Nagaoka I.,
  •   Title:Isolation of cDNA encoding guinea pig neutrophil cationic antibacterial polypeptide of 11 kDa (CAP11) and evaluation of CAP11 mRNA expression during neutrophil maturation.
  •   Journal:J. Biol. Chem., 1997, 272, 22742-22750  [MEDLINE:97426420]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: