Record in detail


General Info

  • lamp_id:L01A002952
  • Name:HOL2_HOLDI
  • FullName:Holotricin-2
  • Source:Holotrichia diomphalia
  • Mass:7857.7 Da
  • Sequence Length:72 aa
  • Isoelectric Point:10.87
  • Activity:Antibacterial
  • Sequence
        SLQPGAPSFPMPGSQLPTSVSGNVEKQGRNTIATIDAQHKTDRYDVRGTWTKVVDGPGRSKPNFRIGGSYRW
  • Function:Antibacterial activity against Gram-negative bacteria but not against Gram-positive bacteria.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002952    From 1 To 72 E-value: 2e-38 Score: 149
        SLQPGAPSFPMPGSQLPTSVSGNVEKQGRNTIATIDAQHKTDRYDVRGTWTKVVDGPGRSKPNFRIGGSYRW
  • 2. L01A002959    From 1 To 72 E-value: 2e-30 Score: 122
        SLQPGAPNFPMPGSQLPTSITSNIEKQGPNTAATINAQHKTDRYDVGATWSKVIRGPGRSKPNWSIGGTYRW
  • 3. L12A11142|    From 1 To 75 E-value: 0.00000000001 Score: 60.1
        SLQPGAPNFPIPGQEKQEGWKFDPSLTRGEDGNTLGSINIHHTGPNHEVGANWDKVIRGPGKAKPTYSIHGSWRW
  • 4. L12A11141|    From 1 To 75 E-value: 0.000000002 Score: 53.1
        SLQPGAPKLPYAWSRKQEGWKFDPSLTRGEDGNTLGSINIHHTGRNHEVGANWNKVIRGPGKAKPTYSIHGSWRW
  • 5. L01A000073    From 1 To 73 E-value: 0.000000008 Score: 50.8
        SLQGGAPNFPQPSQQNGGWQVSPDLGRDDKGNTRGQIEIQNKGKDHDFNAGWGKVIRGPNKAKPTWHVGGTYR

Structure

  •   Domains
  •   1  Name:Coleoptericin    Interpro Link:IPR009382
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Natori S.,Kurama T.,Kurata S.,Moon H.J.,Lee S.Y.,
  •   Title:Purification and molecular cloning of cDNA for an inducible antibacterial protein of larvae of a coleopteran insect, Holotrichia diomphalia.
  •   Journal:J. Biochem., 1994, 115, 82-86  [MEDLINE:94245669]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: