Record in detail


General Info

  • lamp_id:L01A002956
  • Name:DEFD7_SPIOL
  • FullName:Defensin D7
  • Source:Spinacia oleracea
  • Mass:4230.6 Da
  • Sequence Length:38 aa
  • Isoelectric Point:8.65
  • Activity:Antibacterial
  • Sequence
        GIFSSRKCKTPSKTFKGYCTRDSNCDTSCRYEGYPAGD
  • Function:Antimicrobial peptide. Active against Fusarium spp., Gram-positive and Gram-negative bacterial pathogens.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002956    From 1 To 38 E-value: 3e-17 Score: 79
        GIFSSRKCKTPSKTFKGYCTRDSNCDTSCRYEGYPAGD
  • 2. L13A021315    From 1 To 38 E-value: 1e-16 Score: 76.6
        GIFSSRKCKTPSKTFKGICTRDSNCDTSCRYEGYPAGD
  • 3. L01A000715    From 1 To 38 E-value: 2e-16 Score: 76.3
        GIFSSRKCKTPSKTFKGICTRDSNCDTSCRYEGYPAGD
  • 4. L12A06219|    From 30 To 66 E-value: 0.0000002 Score: 46.2
        VAEGRMCKTPSGKFKGYCVNNTNCKNVCRTEGFPTGS
  • 5. L01A000328    From 1 To 25 E-value: 0.0000006 Score: 44.7
        GIFSSRKCKTVSKTFRGICTRNANC

Structure

  •   Domains
  •   1  Name:Gamma-thionin    Interpro Link:IPR008176
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  C. michiganensis  EC:  0.42 μg/ml  (0.0992767 μM)  
  •   2  Target:  R. solanacearum  EC:  4.23 μg/ml  (0.999858 μM)  
  •   3  Target:  F. solani  EC:  38.08 μg/ml  (9.00109 μM)  

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Garcia-Olmedo F.,Molina A.,Moreno M.,Segura A.,
  •   Title:Novel defensin subfamily from spinach (Spinacia oleracea).
  •   Journal:FEBS Lett., 1998, 435, 159-162  [MEDLINE:98433863]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: