Record in detail


General Info

  • lamp_id:L01A002958
  • Name:PFPC_ENTHI
  • FullName:Pore-forming peptide ameobapore C
  • Source:Entamoeba histolytica
  • Mass:8031.6 Da
  • Sequence Length:77 aa
  • Isoelectric Point:4.91
  • Activity:Antibacterial
  • Sequence
        IPVLCPVCTSLVGKLIDLVLGGAVDKVTDYLETLCAKADGLVETLCTKIVSYGIDKLIEKILEGGSAKLICGLIHAC
  • Function:Forms pores in the cytoplasmic membrane of host cells. Has antibacterial activity against M.luteus, no activity against E.coli. Implicated in the cytolytic activity of the parasite.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002958    From 1 To 77 E-value: 2e-37 Score: 146
        IPVLCPVCTSLVGKLIDLVLGGAVDKVTDYLETLCAKADGLVETLCTKIVSYGIDKLIEKILEGGSAKLICGLIHAC
  • 2. L13A016546    From 1 To 50 E-value: 3e-22 Score: 95.5
        IPVLCPVCTSLVGKLIDLVLGGAVDKVTDYLETLCAKADGLVETLCTKIV
  • 3. L03A000126    From 22 To 97 E-value: 8e-17 Score: 77.4
        PIVCNLCTGLINTLENLLTTKGADKVKDYIDSLCNKASGFIATLCTKVLDFGVDKLIQLIEDKVDANAICAKIHAC
  • 4. L03A000125    From 23 To 98 E-value: 3e-16 Score: 75.5
        EILCNLCTGLINTLENLLTTKGADKVKDYISSLCNKASGFIATLCTKVLDFGIDKLIQLIEDKVDANAICAKIHAC
  • 5. L01A000511    From 2 To 77 E-value: 5e-16 Score: 74.7
        EILCNLCTGLINTLENLLTTKGADKVKDYISSLCNKASGFIATLCTKVLDFGIDKLIQLIEDKVDANAICAKIHAC

Structure

  •   Domains
  •   1  Name:SapB_2    Interpro Link:IPR008138
  •   2  Name:Saposin-like    Interpro Link:IPR011001
  •   3  Name:SaposinB    Interpro Link:IPR008139
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Mueller-Eberhard H.J.,Tannich E.,Nickel R.,Andrae J.,Leippe M.,
  •   Title:Amoebapores, a family of membranolytic peptides from cytoplasmic granules of Entamoeba histolytica: isolation, primary structure, and pore formation in bacterial cytoplasmic membranes.
  •   Journal:Mol. Microbiol., 1994, 14, 895-904  [MEDLINE:95231296]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: