Record in detail


General Info

  • lamp_id:L01A002972
  • Name:DEF1_CLITE
  • FullName:Defensin-like protein 1
  • Source:Clitoria ternatea
  • Mass:5613.2 Da
  • Sequence Length:49 aa
  • Isoelectric Point:8.22
  • Activity:Antifungal
  • Sequence
        NLCERASLTWTGNCGNTGHCDTQCRNWESAKHGACHKRGNWKCFCYFNC
  • Function:Possesses antimicrobial activity sensitive to inorganic cations. Binds specifically to the fungal plasma membrane. Has no inhibitory effect on insect gut alpha-amylase.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002972    From 1 To 49 E-value: 4e-24 Score: 101
        NLCERASLTWTGNCGNTGHCDTQCRNWESAKHGACHKRGNWKCFCYFNC
  • 2. L02A000004    From 1 To 49 E-value: 9e-24 Score: 100
        NLCERASLTWTGNCGNTGHCDTQCRNWESAKHGACHKRGNWKCFCYFDC
  • 3. L03A000315    From 1 To 50 E-value: 2e-22 Score: 96.3
        NLCERASLTWTGNCGNTGHCDTQCRNWESAKHGACHKRGINWKCFCYFDC
  • 4. L13A021221    From 2 To 48 E-value: 3e-16 Score: 75.5
        ERPSQTWSGNCGNTAHCDKQCQDWEKASHGACHKRENHWKCFCYFNC
  • 5. L01A002044    From 4 To 50 E-value: 3e-16 Score: 75.5
        ERPSQTWSGNCGNTAHCDKQCQDWEKASHGACHKRENHWKCFCYFNC

Structure

  •   Domains
  •   1  Name:Gamma-thionin    Interpro Link:IPR008176
  •   2  Name:Knot1    Interpro Link:IPR003614
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Botrytis cinerea  IC50:  20 μg/ml  (3.56303 μM)  
  •   2  Target:  Cladosporium sphaerospermum  IC50:  6 μg/ml  (1.06891 μM)  
  •   3  Target:  Fusarium culmorum  IC50:  10 μg/ml  (1.78151 μM)  
  •   4  Target:  Leptosphaeria maculans  IC50:  6 μg/ml  (1.06891 μM)  
  •   5  Target:  Penicillium digitatum  IC50:  20 μg/ml  (3.56303 μM)  
  •   6  Target:  Trichoderma viride  IC50:  100 μg/ml  (17.8151 μM)  
  •   7  Target:  Septoria tritiei  IC50:  2 μg/ml  (0.356303 μM)  
  •   8  Target:  Verticilium albo-atrum  IC50:  2 μg/ml  (0.356303 μM)  
  •   9  Target:  Neurospora crassa  IC50:  0.3 μg/ml  (0.0534455 μM)  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Torrekens S.,Goderis I.,Thevissen K.,De Samblanx G.W.,Osborn R.W.,
  •   Title:Isolation and characterisation of plant defensins from seeds of Asteraceae, Fabaceae, Hippocastanaceae and Saxifragaceae.
  •   Journal:FEBS Lett., 1995, 368, 257-262  [MEDLINE:95354848]
  •   [2]  Broekaert W.F.,Acland D.P.,Osborn R.W.,Thevissen K.,
  •   Title:Specific binding sites for an antifungal plant defensin from Dahlia (Dahlia merckii) on fungal cells are required for antifungal activity.
  •   Journal:Mol. Plant Microbe Interact., 2000, 13, 54-61  [PubMed:10656585]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: