Record in detail
General Info
- lamp_id:L01A002974
- Name:DEF1_PETHY
- FullName:Floral defensin-like protein 1
- Source:Petunia hybrida
- Mass:5211.2 Da
- Sequence Length:47 aa
- Isoelectric Point:8.58
- Activity:Antifungal
- Sequence
ATCKAECPTWDSVCINKKPCVACCKKAKFSDGHCSKILRRCLCTKEC - Function:Plant defense peptide with antifungal activity against F.oxysporum and B.cinerea.
Cross-Linking
- Cross-linking
- 1 Database:APD 981
- 2 Database:CAMP CAMPSQ916
- 3 Database:DBAASP 1954
- 4 Database:dbAMP dbAMP_00628
- 5 Database:DRAMP DRAMP00454
- 6 Database:SATPdb satpdb21213
- 7 Database:Uniprot Q8H6Q1
- 8 Database:PHY PHYT00024
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L01A002974 From 1 To 47 E-value: 1e-21 Score: 93.2
ATCKAECPTWDSVCINKKPCVACCKKAKFSDGHCSKILRRCLCTKEC - 2. L01A002982 From 1 To 49 E-value: 0.000000000000001 Score: 73.9
GTCKAECPTWEGICINKAPCVKCCKAQPEKFTDGHCSKILRRCLCTKPC - 3. L03A000106 From 26 To 70 E-value: 0.000000000000006 Score: 71.2
GTCKAECPTWEGICINKAPCVKCCKAQPEKFTDGHCSKILRRCLC - 4. L11A012616 From 3 To 47 E-value: 0.00000000003 Score: 59.3
CKAESNTFTGICIAKPPCRQACIREKFTDGHCSKVLRRCLCTKRC - 5. L11A012617 From 3 To 47 E-value: 0.00000000004 Score: 58.5
CKAESNTFTGICIAKPPCRKACIREKFTDGHCSKVLRRCLCTKRC
Activity
- Antibacterial Activities
- 1 Target: Fusarium oxysporum MIC: 10 μg/ml (1.91894 μM)
- 2 Target: Botrytis cinerea MIC: 10 μg/ml (1.91894 μM)
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Anderson M.A.,Brugliera F.,Lay F.T.,
- Title:Isolation and properties of floral defensins from ornamental tobacco and petunia.
- Journal:Plant Physiol., 2003, 131, 1283-1293 [PubMed:12644678]
- [2] Craik D.J.,Anderson M.A.,Lay F.T.,Schirra H.J.,Janssen B.-J.,
- Title:Structure of Petunia hybrida defensin 1, a novel plant defensin with five disulfide bonds.
- Journal:Biochemistry, 2003, 42, 8214-8222 [PubMed:12846570]
Comments
- Comments
No comments found on LAMP database