Record in detail


General Info

  • lamp_id:L01A002974
  • Name:DEF1_PETHY
  • FullName:Floral defensin-like protein 1
  • Source:Petunia hybrida
  • Mass:5211.2 Da
  • Sequence Length:47 aa
  • Isoelectric Point:8.58
  • Activity:Antifungal
  • Sequence
        ATCKAECPTWDSVCINKKPCVACCKKAKFSDGHCSKILRRCLCTKEC
  • Function:Plant defense peptide with antifungal activity against F.oxysporum and B.cinerea.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002974    From 1 To 47 E-value: 1e-21 Score: 93.2
        ATCKAECPTWDSVCINKKPCVACCKKAKFSDGHCSKILRRCLCTKEC
  • 2. L01A002982    From 1 To 49 E-value: 0.000000000000001 Score: 73.9
        GTCKAECPTWEGICINKAPCVKCCKAQPEKFTDGHCSKILRRCLCTKPC
  • 3. L03A000106    From 26 To 70 E-value: 0.000000000000006 Score: 71.2
        GTCKAECPTWEGICINKAPCVKCCKAQPEKFTDGHCSKILRRCLC
  • 4. L11A012616    From 3 To 47 E-value: 0.00000000003 Score: 59.3
        CKAESNTFTGICIAKPPCRQACIREKFTDGHCSKVLRRCLCTKRC
  • 5. L11A012617    From 3 To 47 E-value: 0.00000000004 Score: 58.5
        CKAESNTFTGICIAKPPCRKACIREKFTDGHCSKVLRRCLCTKRC

Structure

  •   Domains
  •   1  Name:Gamma-thionin    Interpro Link:IPR008176
  •   2  Name:Knot1    Interpro Link:IPR003614
  •   Structures

Activity

  •   Antibacterial Activities
  •   1  Target:  Fusarium oxysporum  MIC:  10 μg/ml  (1.91894 μM)  
  •   2  Target:  Botrytis cinerea  MIC:  10 μg/ml  (1.91894 μM)  

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Anderson M.A.,Brugliera F.,Lay F.T.,
  •   Title:Isolation and properties of floral defensins from ornamental tobacco and petunia.
  •   Journal:Plant Physiol., 2003, 131, 1283-1293  [PubMed:12644678]
  •   [2]  Craik D.J.,Anderson M.A.,Lay F.T.,Schirra H.J.,Janssen B.-J.,
  •   Title:Structure of Petunia hybrida defensin 1, a novel plant defensin with five disulfide bonds.
  •   Journal:Biochemistry, 2003, 42, 8214-8222  [PubMed:12846570]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: