Record in detail


General Info

  • lamp_id:L01A002979
  • Name:DEF18_ARATH
  • FullName:Defensin-like protein 18
  • Source:Arabidopsis thaliana
  • Mass:5887.4 Da
  • Sequence Length:50 aa
  • Isoelectric Point:6.98
  • Activity:Antifungal
  • Sequence
        LCKRESETWSGRCVNDYQCRDHCINNDRGNDGYCAGGYPWYRSCFCFFSC
  • Function:Confers broad-spectrum resistance to pathogens.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000093    From 31 To 80 E-value: 2e-26 Score: 109
        LCKRESETWSGRCVNDYQCRDHCINNDRGNDGYCAGGYPWYRSCFCFFSC
  • 2. L01A002979    From 1 To 50 E-value: 4e-25 Score: 105
        LCKRESETWSGRCVNDYQCRDHCINNDRGNDGYCAGGYPWYRSCFCFFSC
  • 3. L01A002170    From 3 To 51 E-value: 0.0000001 Score: 46.6
        LCERPSGTWSGVCMNNNACKNQCINLEKARHGSCNYVFPAHK-CICYFPC
  • 4. L01A002146    From 3 To 51 E-value: 0.0000002 Score: 46.2
        LCQRPSGTWSGVCGNNNACKNQCIRLEKARHGSCNGVFPAHK-CICYFPC
  • 5. L12A06263|    From 32 To 80 E-value: 0.0000002 Score: 46.2
        LCERPSGTWSGVCGNNNACKNQCINLEKARHGSCNYVFPAHK-CICYFPC

Structure

  •   Domains
  •   1  Name:Gamma-thionin    Interpro Link:IPR008176
  •   2  Name:Knot1    Interpro Link:IPR003614
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Kaul S.,Federspiel N.A.,Palm C.J.,Ecker J.R.,Theologis A.,
  •   Title:Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana.
  •   Journal:Nature, 2000, 408, 816-820  [MEDLINE:21016719]
  •   [2]  Thevissen K.,Cammue B.P.,Thomma B.P.H.J.,
  •   Title:Plant defensins.
  •   Journal:Planta, 2002, 216, 193-202  [PubMed:12447532]
  •   [3]  VandenBosch K.A.,Paape T.D.,Graham M.A.,Silverstein K.A.T.,
  •   Title:Genome organization of more than 300 defensin-like genes in Arabidopsis.
  •   Journal:Plant Physiol., 2005, 138, 600-610  [PubMed:15955924]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: