Record in detail


General Info

  • lamp_id:L01A002982
  • Name:DEF2_PETHY
  • FullName:Floral defensin-like protein 2
  • Source:Petunia hybrida
  • Mass:5403.4 Da
  • Sequence Length:49 aa
  • Isoelectric Point:8.43
  • Activity:Antifungal
  • Sequence
        GTCKAECPTWEGICINKAPCVKCCKAQPEKFTDGHCSKILRRCLCTKPC
  • Function:Plant defense peptide with antifungal activity against F.oxysporum and B.cinerea.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002982    From 1 To 49 E-value: 3e-23 Score: 99
        GTCKAECPTWEGICINKAPCVKCCKAQPEKFTDGHCSKILRRCLCTKPC
  • 2. L03A000106    From 26 To 70 E-value: 3e-22 Score: 95.1
        GTCKAECPTWEGICINKAPCVKCCKAQPEKFTDGHCSKILRRCLC
  • 3. L01A002974    From 1 To 47 E-value: 9e-16 Score: 73.9
        ATCKAECPTWDSVCINKKPCVACCK--KAKFSDGHCSKILRRCLCTKEC
  • 4. L01A003064    From 3 To 47 E-value: 0.000000000001 Score: 63.9
        CKTESNTFPGICITKPPCRKACIS--EKFTDGHCSKLLRRCLCTKPC
  • 5. L11A010686    From 2 To 47 E-value: 0.000000000002 Score: 62.4
        TCESQSNTFPGICITKPPCRKACIS--EKFTDGHCSKILRRCLCTKPC

Structure

  •   Domains
  •   1  Name:Gamma-thionin    Interpro Link:IPR008176
  •   2  Name:Knot1    Interpro Link:IPR003614
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Anderson M.A.,Brugliera F.,Lay F.T.,
  •   Title:Isolation and properties of floral defensins from ornamental tobacco and petunia.
  •   Journal:Plant Physiol., 2003, 131, 1283-1293  [PubMed:12644678]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: