Record in detail


General Info

  • lamp_id:L01A002984
  • Name:SCAB_ORYRH
  • FullName:Scarabaecin
  • Source:Oryctes rhinoceros
  • Mass:4080.7 Da
  • Sequence Length:36 aa
  • Isoelectric Point:9.55
  • Activity:Antibacterial, Antifungal
  • Sequence
        ELPKLPDDKVLIRSRSNCPKGKVWNGFDCKSPFAFS
  • Function:Possesses antifungal activity against phytopathogenic fungi such as P.oryzae, R.solani and B.cinerea but not against phytopathogenic bacteria. Shows weak activity against the insect pathogenic fungus B.bassiana and against S.aureus. Binds chitin.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000179    From 29 To 64 E-value: 6e-17 Score: 77.8
        ELPKLPDDKVLIRSRSNCPKGKVWNGFDCKSPFAFS
  • 2. L01A002984    From 1 To 36 E-value: 2e-16 Score: 75.9
        ELPKLPDDKVLIRSRSNCPKGKVWNGFDCKSPFAFS

Structure

  •   Domains
  •   1  Name:Chitin-bd_dom    Interpro Link:IPR002557
  •   Structures

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Sawahata R.,Kobayashi S.,Furukawa S.,Ishibashi J.,Tomie T.,
  •   Title:Scarabaecin, a novel cysteine-containing antifungal peptide from the rhinoceros beetle, Oryctes rhinoceros.
  •   Journal:Biochem. Biophys. Res. Commun., 2003, 307, 261-266  [PubMed:12859949]
  •   [2]  Yamakawa M.,Tomie T.,Ishibashi J.,Hemmi H.,
  •   Title:Structural basis for new pattern of conserved amino acid residues related to chitin-binding in the antifungal peptide from the coconut rhinoceros beetle Oryctes rhinoceros.
  •   Journal:J. Biol. Chem., 2003, 278, 22820-22827  [PubMed:12676931]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: