Record in detail


General Info

  • lamp_id:L01A002985
  • Name:P91818_TACTR
  • FullName:
  • Source:Tachypleus tridentatus
  • Mass:8373.6 Da
  • Sequence Length:73 aa
  • Isoelectric Point:8.26
  • Activity:Antibacterial, Antifungal
  • Sequence
        YLAFRCGRYSPCLDDGPNVNLYSCCSFYNCHKCLARLENCPKGLHYNAYLKVCDWPSKAGCTSVNKECHLWKT
  • Function:null

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000107    From 23 To 95 E-value: 2e-40 Score: 155
        YLAFRCGRYSPCLDDGPNVNLYSCCSFYNCHKCLARLENCPKGLHYNAYLKVCDWPSKAGCTSVNKECHLWKT
  • 2. L12A12224|    From 1 To 73 E-value: 4e-39 Score: 151
        YLAFRCGRYSPCLDDGPNVNLYSCCSFYNCHKCLARLENCPKGLHYNAYLKVCDWPSKAGCTSVNKECHLWKT
  • 3. L01A002985    From 1 To 73 E-value: 4e-39 Score: 151
        YLAFRCGRYSPCLDDGPNVNLYSCCSFYNCHKCLARLENCPKGLHYNAYLKVCDWPSKAGCTSVNKECHLWKT
  • 4. L02A001153    From 1 To 62 E-value: 2e-32 Score: 129
        YLAFRCGRYSPCLDDGPNVNLYSCCSFYNCHKCLARLENCPKGLHYNAYLKVCDWPSKAGCT
  • 5. L13A014925    From 1 To 50 E-value: 6e-25 Score: 104
        YLAFRCGRYSPCLDDGPNVNLYSCCSFYNCHKCLARLENCPKGLHYNAYL

Structure

  •   Domains
  •   1  Name:Chitin-bd_dom    Interpro Link:IPR002557
  •   Structures

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Agarwala K.L.,Shigenaga T.,Hirata M.,Nagayama R.,Kawabata S.,
  •   Title:Tachycitin, a small granular component in horseshoe crab hemocytes, is an antimicrobial protein with chitin-binding activity.
  •   Journal:J. Biochem., 1996, 120, 1253-1260  [MEDLINE:97164031]
  •   [2]  Iwanaga S.,Miura K.,Kawabata S.,Tsuda S.,Suetake T.,
  •   Title:Chitin-binding proteins in invertebrates and plants comprise a common chitin-binding structural motif.
  •   Journal:J. Biol. Chem., 2000, 275, 17929-17932  [MEDLINE:20309732]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: