Record in detail
General Info
- lamp_id:L01A002987
- Name:THHS_HORVU
- FullName:Antifungal protein S
- Source:Hordeum vulgare
- Mass:3765.3 Da
- Sequence Length:37 aa
- Isoelectric Point:8.52
- Activity:Antifungal
- Sequence
ATFTVINKCQYTVWAAAVPAGGGQKLDAGQTWSIXXP - Function:Has antifungal activity. Inhibits the growth of Trichoderma viridae and Candida albicans.
Cross-Linking
- Cross-linking
- 1 Database:CAMP CAMPSQ926
- 2 Database:dbAMP dbAMP_00651
- 3 Database:DRAMP DRAMP00343
- 4 Database:Uniprot P33045
- 5 Database:AMD THHS_HORVU
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L01A002987 From 1 To 37 E-value: 0.000000000000002 Score: 72.4
ATFTVINKCQYTVWAAAVPAGGGQKLDAGQTWSIXXP - 2. L12A00504| From 1 To 37 E-value: 0.0000000009 Score: 53.9
ARFDIQNKCPYTVWAASVPVGGGRQLNSGQTWXIDAP - 3. L12A00654| From 1 To 37 E-value: 0.000000003 Score: 52.4
ATIEVRNNCPYTVWAASTPIGGGRRLDRGQTWVINAP - 4. L13A020819 From 1 To 33 E-value: 0.00000002 Score: 49.3
ATFTIRNNCPYTIWAAAVP-GGGRRLNSGGTWTI - 5. L01A002986 From 1 To 36 E-value: 0.00000004 Score: 48.5
ATITVVNRCSYTVWPGALP-GGGVRLDPGQRWALNMP
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Svendsen I.,Jacobsen S.,Hejgaard J.,
- Title:Two antifungal thaumatin-like proteins from barley grain.
- Journal:FEBS Lett., 1991, 291, 127-131 [MEDLINE:92037994]
Comments
- Comments
No comments found on LAMP database