Record in detail
General Info
- lamp_id:L01A002992
- Name:TACA1_TACTR
- FullName:Tachystatin-A1
- Source:Tachypleus tridentatus
- Mass:5045.8 Da
- Sequence Length:44 aa
- Isoelectric Point:9.12
- Activity:Antibacterial, Antifungal
- Sequence
YSRCQLQGFNCVVRSYGLPTIPCCRGLTCRSYFPGSTYGRCQRF - Function:Exhibits stronger antimicrobial activity against the Gram-positive bacteria (S.aureus (IC(50) is 4.2 ug/ml)) and fungi (C.albicans (IC(50) is 3.0 ug/ml) and P.pastoris (IC(50) is 0.5 ug/ml)) than Gram-negative bacteria (E.coli (IC(50) is 25 ug/ml)). Binds to chitin (8.4 uM are required to obtain 50% of binding). Does not cause hemolysis on sheep erythrocytes. Has no blocking activity on the P-type calcium channel.
Cross-Linking
- Cross-linking
- 1 Database:CAMP CAMPSQ930
- 2 Database:DBAASP 1956
- 3 Database:dbAMP dbAMP_12288
- 4 Database:DRAMP DRAMP02941
- 5 Database:SATPdb satpdb11549
- 6 Database:Uniprot P0C1Z7
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L03A000161 From 24 To 67 E-value: 4e-21 Score: 91.7
YSRCQLQGFNCVVRSYGLPTIPCCRGLTCRSYFPGSTYGRCQRF - 2. L12A08087| From 24 To 67 E-value: 1e-20 Score: 90.5
YSRCQLQGFNCVVRSYGLPTIPCCRGLTCRSYFPGSTYGRCQRY - 3. L01A002992 From 1 To 44 E-value: 2e-20 Score: 89.4
YSRCQLQGFNCVVRSYGLPTIPCCRGLTCRSYFPGSTYGRCQRF - 4. L01A002892 From 1 To 44 E-value: 4e-20 Score: 88.2
YSRCQLQGFNCVVRSYGLPTIPCCRGLTCRSYFPGSTYGRCQRY - 5. L13A023384 From 1 To 39 E-value: 7e-16 Score: 74.3
YSRCQLQGFNCVVRSYGLPTIPCCRG----SYFPGSTYGRCQR
Structure
- Domains
- 1 Name:Antimicrobial_tachystatin_A Interpro Link:IPR022717
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
- 1 Target: E. coli IC50: 25 μg/ml (4.95462 μM)
- 2 Target: S. aureus IC50: 4.2 μg/ml (0.832375 μM)
- 3 Target: C. albicans IC50: 3 μg/ml (0.594554 μM)
- 4 Target: P. pastoris IC50: 0.5 μg/ml (0.0990923 μM)
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Iwanaga S.,Hirata M.,Nagayama R.,Omotezako M.,Osaki T.,
- Title:Horseshoe crab hemocyte-derived antimicrobial polypeptides, tachystatins, with sequence similarity to spider neurotoxins.
- Journal:J. Biol. Chem., 1999, 274, 26172-26178 [MEDLINE:99403058]
Comments
- Comments
No comments found on LAMP database