Record in detail


General Info

  • lamp_id:L01A002992
  • Name:TACA1_TACTR
  • FullName:Tachystatin-A1
  • Source:Tachypleus tridentatus
  • Mass:5045.8 Da
  • Sequence Length:44 aa
  • Isoelectric Point:9.12
  • Activity:Antibacterial, Antifungal
  • Sequence
        YSRCQLQGFNCVVRSYGLPTIPCCRGLTCRSYFPGSTYGRCQRF
  • Function:Exhibits stronger antimicrobial activity against the Gram-positive bacteria (S.aureus (IC(50) is 4.2 ug/ml)) and fungi (C.albicans (IC(50) is 3.0 ug/ml) and P.pastoris (IC(50) is 0.5 ug/ml)) than Gram-negative bacteria (E.coli (IC(50) is 25 ug/ml)). Binds to chitin (8.4 uM are required to obtain 50% of binding). Does not cause hemolysis on sheep erythrocytes. Has no blocking activity on the P-type calcium channel.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000161    From 24 To 67 E-value: 4e-21 Score: 91.7
        YSRCQLQGFNCVVRSYGLPTIPCCRGLTCRSYFPGSTYGRCQRF
  • 2. L12A08087|    From 24 To 67 E-value: 1e-20 Score: 90.5
        YSRCQLQGFNCVVRSYGLPTIPCCRGLTCRSYFPGSTYGRCQRY
  • 3. L01A002992    From 1 To 44 E-value: 2e-20 Score: 89.4
        YSRCQLQGFNCVVRSYGLPTIPCCRGLTCRSYFPGSTYGRCQRF
  • 4. L01A002892    From 1 To 44 E-value: 4e-20 Score: 88.2
        YSRCQLQGFNCVVRSYGLPTIPCCRGLTCRSYFPGSTYGRCQRY
  • 5. L13A023384    From 1 To 39 E-value: 7e-16 Score: 74.3
        YSRCQLQGFNCVVRSYGLPTIPCCRG----SYFPGSTYGRCQR

Structure

  •   Domains
  •   1  Name:Antimicrobial_tachystatin_A    Interpro Link:IPR022717
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  E. coli  IC50:  25 μg/ml  (4.95462 μM)  
  •   2  Target:  S. aureus  IC50:  4.2 μg/ml  (0.832375 μM)  
  •   3  Target:  C. albicans  IC50:  3 μg/ml  (0.594554 μM)  
  •   4  Target:  P. pastoris  IC50:  0.5 μg/ml  (0.0990923 μM)  

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Iwanaga S.,Hirata M.,Nagayama R.,Omotezako M.,Osaki T.,
  •   Title:Horseshoe crab hemocyte-derived antimicrobial polypeptides, tachystatins, with sequence similarity to spider neurotoxins.
  •   Journal:J. Biol. Chem., 1999, 274, 26172-26178  [MEDLINE:99403058]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: