Record in detail


General Info

  • lamp_id:L01A002993
  • Name:TACHC_TACTR
  • FullName:Tachystatin-C
  • Source:Tachypleus tridentatus
  • Mass:4921.6 Da
  • Sequence Length:41 aa
  • Isoelectric Point:9.55
  • Activity:Antibacterial, Antifungal
  • Sequence
        DYDWSLRGPPKCATYGQKCRTWSPPNCCWNLRCKAFRCRPR
  • Function:Binds to chitin. Shows strong activity against E.coli (IC(50) is 1.2 ug/ml). Is also very active against S.aureus (IC(50) is 0.8 ug/ml), C.albicans (IC(50) is 0.9 ug/ml) and P.pastoris (IC(50) is 0.3 ug/ml). Binds to chitin (5.2 uM are required to obtain 50% of binding). Causes hemolysis on sheep erythrocytes, probably by forming ion-permeable pores.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002993    From 1 To 41 E-value: 2e-19 Score: 85.9
        DYDWSLRGPPKCATYGQKCRTWSPPNCCWNLRCKAFRCRPR
  • 2. L02A001009    From 1 To 41 E-value: 1e-18 Score: 83.2
        DYDWSLRGPPKCATYGQKCRTWSPRNCCWNLRCKAFRCRPR
  • 3. L01A002991    From 3 To 26 E-value: 3.1 Score: 22.3
        SCLFRGARCRVYSGRSCCFGYYCR
  • 4. L01A003326    From 4 To 26 E-value: 3.4 Score: 22.3
        CLFRGARCRVYSGRSCCFGYYCR
  • 5. L12A10090|    From 13 To 29 E-value: 5.6 Score: 21.6
        GQQLRNISPPQRCPSLR

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  E. coli  IC50:  1.2 μg/ml  (0.243823 μM)  
  •   2  Target:  S. aureus  IC50:  0.8 μg/ml  (0.162549 μM)  
  •   3  Target:  C. albicans  IC50:  0.9 μg/ml  (0.182867 μM)  
  •   4  Target:  P. pastoris  IC50:  0.3 μg/ml  (0.0609558 μM)  

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Iwanaga S.,Hirata M.,Nagayama R.,Omotezako M.,Osaki T.,
  •   Title:Horseshoe crab hemocyte-derived antimicrobial polypeptides, tachystatins, with sequence similarity to spider neurotoxins.
  •   Journal:J. Biol. Chem., 1999, 274, 26172-26178  [MEDLINE:99403058]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: