Record in detail
General Info
- lamp_id:L01A002993
- Name:TACHC_TACTR
- FullName:Tachystatin-C
- Source:Tachypleus tridentatus
- Mass:4921.6 Da
- Sequence Length:41 aa
- Isoelectric Point:9.55
- Activity:Antibacterial, Antifungal
- Sequence
DYDWSLRGPPKCATYGQKCRTWSPPNCCWNLRCKAFRCRPR - Function:Binds to chitin. Shows strong activity against E.coli (IC(50) is 1.2 ug/ml). Is also very active against S.aureus (IC(50) is 0.8 ug/ml), C.albicans (IC(50) is 0.9 ug/ml) and P.pastoris (IC(50) is 0.3 ug/ml). Binds to chitin (5.2 uM are required to obtain 50% of binding). Causes hemolysis on sheep erythrocytes, probably by forming ion-permeable pores.
Cross-Linking
- Cross-linking
- 1 Database:CAMP CAMPSQ931
- 2 Database:DBAASP 1851
- 3 Database:dbAMP dbAMP_01268
- 4 Database:DRAMP DRAMP02945
- 5 Database:SATPdb satpdb13169
- 6 Database:Uniprot P0C200
- 7 Database:AMD TACC_TACTR
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L01A002993 From 1 To 41 E-value: 2e-19 Score: 85.9
DYDWSLRGPPKCATYGQKCRTWSPPNCCWNLRCKAFRCRPR - 2. L02A001009 From 1 To 41 E-value: 1e-18 Score: 83.2
DYDWSLRGPPKCATYGQKCRTWSPRNCCWNLRCKAFRCRPR - 3. L01A002991 From 3 To 26 E-value: 3.1 Score: 22.3
SCLFRGARCRVYSGRSCCFGYYCR - 4. L01A003326 From 4 To 26 E-value: 3.4 Score: 22.3
CLFRGARCRVYSGRSCCFGYYCR - 5. L12A10090| From 13 To 29 E-value: 5.6 Score: 21.6
GQQLRNISPPQRCPSLR
Structure
- Domains
No domains found on LAMP database
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
- 1 Target: E. coli IC50: 1.2 μg/ml (0.243823 μM)
- 2 Target: S. aureus IC50: 0.8 μg/ml (0.162549 μM)
- 3 Target: C. albicans IC50: 0.9 μg/ml (0.182867 μM)
- 4 Target: P. pastoris IC50: 0.3 μg/ml (0.0609558 μM)
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Iwanaga S.,Hirata M.,Nagayama R.,Omotezako M.,Osaki T.,
- Title:Horseshoe crab hemocyte-derived antimicrobial polypeptides, tachystatins, with sequence similarity to spider neurotoxins.
- Journal:J. Biol. Chem., 1999, 274, 26172-26178 [MEDLINE:99403058]
Comments
- Comments
No comments found on LAMP database