Record in detail


General Info

  • lamp_id:L01A002999
  • Name:DEF1_CAPAN
  • FullName:Defensin J1-1
  • Source:Capsicum annuum
  • Mass:5196 Da
  • Sequence Length:48 aa
  • Isoelectric Point:8.21
  • Activity:Antifungal
  • Sequence
        KICEALSGNFKGLCLSSRDCGNVCRREGFTDGSCIGFRLQCFCTKPCA
  • Function:Plant defense peptide with antifungal activity against F.oxysporum and B.cinerea.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000089    From 28 To 75 E-value: 9e-24 Score: 100
        KICEALSGNFKGLCLSSRDCGNVCRREGFTDGSCIGFRLQCFCTKPCA
  • 2. L01A002001    From 27 To 74 E-value: 1e-23 Score: 100
        KICEALSGNFKGLCLSSRDCGNVCRREGFTDGSCIGFRLQCFCTKPCA
  • 3. L01A002999    From 1 To 48 E-value: 1e-22 Score: 97.1
        KICEALSGNFKGLCLSSRDCGNVCRREGFTDGSCIGFRLQCFCTKPCA
  • 4. L05ADEF280    From 30 To 76 E-value: 0.00000000003 Score: 58.9
        RTCETSSNLFNGPCLSSSNCANVCHNEGFSDGDCRGFRRRCLCTRPC
  • 5. L06AT00035    From 1 To 47 E-value: 0.00000000004 Score: 58.2
        RTCETSSNLFNGPCLSSSNCANVCHNEGFSDGDCRGFRRRCLCTRPC

Structure

  •   Domains
  •   1  Name:G_Purothionin    Interpro Link:IPR008177
  •   2  Name:Gamma-thionin    Interpro Link:IPR008176
  •   3  Name:Knot1    Interpro Link:IPR003614
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Schantz R.,Schantz M.L.,Pozueta-Romero J.,Houlne G.,Meyer B.,
  •   Title:Fruit-specific expression of a defensin-type gene family in bell pepper. Upregulation during ripening and upon wounding.
  •   Journal:Plant Physiol., 1996, 112, 615-622  [MEDLINE:97037730]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: