Record in detail
General Info
- lamp_id:L01A003003
- Name:DEFB1_NOMCO
- FullName:Beta-defensin 1
- Source:Nomascus concolor
- Mass:3991.6 Da
- Sequence Length:36 aa
- Isoelectric Point:8.6
- Activity:Antibacterial
- Sequence
DHYNCVRSGGQCLYSACPIYTKIQGTCYQGKAKCCK - Function:Has bactericidal activity (By similarity).
Cross-Linking
- Cross-linking
- 1 Database:CAMP CAMPSQ1602
- 2 Database:dbAMP dbAMP_01055
- 3 Database:DRAMP DRAMP02738
- 4 Database:Uniprot Q7JGM2
- 5 Database:DEF DEF97
- 6 Database:DEF DEF99
- 7 Database:DEF DEF100
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L03A000294 From 33 To 68 E-value: 6e-17 Score: 77.8
DHYNCVRSGGQCLYSACPIYTKIQGTCYQGKAKCCK - 2. L03A000296 From 33 To 68 E-value: 3e-16 Score: 75.9
DHYNCVRSGGQCLYSACPIYTKIQGTCYHGKAKCCK - 3. L03A000293 From 33 To 68 E-value: 3e-16 Score: 75.5
DHYNCVRSGGQCLYSACPIYTKIQGTCYHGKAKCCK - 4. L01A003003 From 1 To 36 E-value: 4e-16 Score: 75.1
DHYNCVRSGGQCLYSACPIYTKIQGTCYQGKAKCCK - 5. L03A000295 From 33 To 68 E-value: 5e-16 Score: 74.7
DHYNCVRSGGQCLYSACPIYTRIQGTCYHGKAKCCK
Structure
- Domains
- 1 Name:Defensin_beta-typ Interpro Link:IPR001855
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Spano A.,Cervella P.,Zuccon D.,Boniotto M.,Del Pero M.,
- Title:Beta-defensin 1 gene variability among non-human primates.
- Journal:Immunogenetics, 2002, 53, 907-913 [MEDLINE:21850507]
Comments
- Comments
No comments found on LAMP database