Record in detail


General Info

  • lamp_id:L01A003003
  • Name:DEFB1_NOMCO
  • FullName:Beta-defensin 1
  • Source:Nomascus concolor
  • Mass:3991.6 Da
  • Sequence Length:36 aa
  • Isoelectric Point:8.6
  • Activity:Antibacterial
  • Sequence
        DHYNCVRSGGQCLYSACPIYTKIQGTCYQGKAKCCK
  • Function:Has bactericidal activity (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000294    From 33 To 68 E-value: 6e-17 Score: 77.8
        DHYNCVRSGGQCLYSACPIYTKIQGTCYQGKAKCCK
  • 2. L03A000296    From 33 To 68 E-value: 3e-16 Score: 75.9
        DHYNCVRSGGQCLYSACPIYTKIQGTCYHGKAKCCK
  • 3. L03A000293    From 33 To 68 E-value: 3e-16 Score: 75.5
        DHYNCVRSGGQCLYSACPIYTKIQGTCYHGKAKCCK
  • 4. L01A003003    From 1 To 36 E-value: 4e-16 Score: 75.1
        DHYNCVRSGGQCLYSACPIYTKIQGTCYQGKAKCCK
  • 5. L03A000295    From 33 To 68 E-value: 5e-16 Score: 74.7
        DHYNCVRSGGQCLYSACPIYTRIQGTCYHGKAKCCK

Structure

  •   Domains
  •   1  Name:Defensin_beta-typ    Interpro Link:IPR001855
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Spano A.,Cervella P.,Zuccon D.,Boniotto M.,Del Pero M.,
  •   Title:Beta-defensin 1 gene variability among non-human primates.
  •   Journal:Immunogenetics, 2002, 53, 907-913  [MEDLINE:21850507]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: