Record in detail


General Info

  • lamp_id:L01A003006
  • Name:DEF4_LEIQH
  • FullName:4 kDa defensin
  • Source:Leiurus quinquestriatus hebraeus
  • Mass:4325.9 Da
  • Sequence Length:38 aa
  • Isoelectric Point:9.59
  • Activity:Antibacterial
  • Sequence
        GFGCPLNQGACHRHCRSIRRRGGYCAGFFKQTCTCYRN
  • Function:Antibacterial protein against Gram-positive bacteria; may act via membrane-permeabilization of these cells.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003006    From 1 To 38 E-value: 3e-17 Score: 78.6
        GFGCPLNQGACHRHCRSIRRRGGYCAGFFKQTCTCYRN
  • 2. L12A01314|    From 14 To 51 E-value: 1e-16 Score: 76.6
        GFGCPLNQGACHRHCRSIRRRGGYCSGIIKQTCTCYRN
  • 3. L03A000241    From 37 To 74 E-value: 4e-16 Score: 75.5
        GFGCPLNQGACHNHCRSIRRRGGYCSGIIKQTCTCYRN
  • 4. L12A11860|    From 15 To 52 E-value: 6e-16 Score: 74.7
        GFGCPLNQGACHNHCRSIRRRGGYCSGIIKQTCTCYRN
  • 5. L01A000718    From 1 To 38 E-value: 9e-16 Score: 73.9
        GFGCPFNQGACHRHCRSIRRRGGYCAGLIKQTCTCYRN

Structure

  •   Domains
  •   1  Name:Defensin_invertebrate/fungal    Interpro Link:IPR001542
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Bouet F.,Bulet P.,Bontems F.,Goyffon M.,Cociancich S.,
  •   Title:Purification and characterization of a scorpion defensin, a 4kDa antibacterial peptide presenting structural similarities with insect defensins and scorpion toxins.
  •   Journal:Biochem. Biophys. Res. Commun., 1993, 194, 17-22  [MEDLINE:93326112]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: