Record in detail

Top similar AMPs on LAMP
1. L05ADEF164 From 23 To 64 E-value: 3e-20 Score: 89
TLYRRFLCKKMNGQCEAECFTFEQKIGTCQANFLCCRKRKEH
2. L01A003013 From 1 To 42 E-value: 1e-19 Score: 86.7
TLYRRFLCKKMNGQCEAECFTFEQKIGTCQANFLCCRKRKEH
3. L01A003681 From 1 To 44 E-value: 0.000000000009 Score: 60.5
TLYRRFLCKKMKGRCETACLSFEKKIGTCRADLTPLCCKEKKKH
4. L12A00243| From 1 To 44 E-value: 0.000000007 Score: 50.8
AIHRALICKRMEGHCEAECLTFEVKIGGCRAELTPYCCKRRKKH
5. L01A003504 From 1 To 44 E-value: 0.000000008 Score: 50.8
AIHRALICKRMEGHCEAECLTFEAKIGGCRAELAPFCCKNRKKH

Reference
[1] Dorin J.R.,Hill R.E.,Kilanowski F.M.,Semple C.A.M.,Morrison G.M.,
Title:Signal sequence conservation and mature peptide divergence within subgroups of the murine beta-defensin gene family.
Journal:Mol. Biol. Evol., 2003, 20, 460-470 [PubMed:12644567]
[2] Marquez G.,Martinez-A C.,Albar J.P.,Villares R.,Zaballos A.,
Title:Identification on mouse chromosome 8 of new beta-defensin genes with regionally specific expression in the male reproductive organ.
Journal:J. Biol. Chem., 2004, 279, 12421-12426 [PubMed:14718547]
[3] Goldstein S.,Zody M.C.,Hillier L.W.,Goodstadt L.,Church D.M.,
Title:Lineage-specific biology revealed by a finished genome assembly of the mouse.
Journal:PLoS Biol., 2009, 7, 0-0 [PubMed:19468303]