Record in detail


General Info

  • lamp_id:L01A003014
  • Name:DFB12_MOUSE
  • FullName:Beta-defensin 12
  • Source:Mus musculus
  • Mass:5805.7 Da
  • Sequence Length:51 aa
  • Isoelectric Point:8.28
  • Activity:Antibacterial
  • Sequence
        GLEYSQSFPGGEIAVCETCRLGRGKCRRTCIESEKIAGWCKLNFFCCRERI
  • Function:Has antibacterial activity (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L05ADEF163    From 35 To 85 E-value: 2e-25 Score: 105
        GLEYSQSFPGGEIAVCETCRLGRGKCRRTCIESEKIAGWCKLNFFCCRERI
  • 2. L01A003014    From 1 To 51 E-value: 1e-24 Score: 103
        GLEYSQSFPGGEIAVCETCRLGRGKCRRTCIESEKIAGWCKLNFFCCRERI
  • 3. L01A003680    From 1 To 51 E-value: 1e-22 Score: 96.7
        GLEYSQSFPGGEFAVCETCRLGRGKCRRTCLDSEKIAGKCKLNFFCCRERI
  • 4. L12A03268|    From 1 To 51 E-value: 3e-21 Score: 92
        GLEYSQSFPGGEFSVCETCRLGRGKCRKVCLESERIAGKCKLNFFCCRERI
  • 5. L12A06581|    From 12 To 62 E-value: 7e-19 Score: 84.3
        GLEYSQPFPGGEFAACEPCRLGRGKCRKVCTEDEKVVGSCKLNFFCCRRRI

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Tomita T.,Fukuhara S.,Makita R.,Nagase T.,Yamaguchi Y.,
  •   Title:Identification of multiple novel epididymis-specific beta-defensin isoforms in humans and mice.
  •   Journal:J. Immunol., 2002, 169, 2516-2523  [MEDLINE:22181517]
  •   [2]  Marquez G.,Martinez-A C.,Albar J.P.,Villares R.,Zaballos A.,
  •   Title:Identification on mouse chromosome 8 of new beta-defensin genes with regionally specific expression in the male reproductive organ.
  •   Journal:J. Biol. Chem., 2004, 279, 12421-12426  [PubMed:14718547]
  •   [3]  Frith M.C.,Gough J.,Katayama S.,Kasukawa T.,Carninci P.,
  •   Title:The transcriptional landscape of the mammalian genome.
  •   Journal:Science, 2005, 309, 1559-1563  [PubMed:16141072]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: