Record in detail


General Info

  • lamp_id:L01A003020
  • Name:DFB19_MOUSE
  • FullName:Beta-defensin 19
  • Source:Mus musculus
  • Mass:7547.6 Da
  • Sequence Length:64 aa
  • Isoelectric Point:8.84
  • Activity:Antibacterial
  • Sequence
        GKNPILQCMGNRGFCRSSCKKSEQAYFYCRTFQMCCLQSYVRISLTGVDDNTNWSYEKHWPRIP
  • Function:Has antibacterial activity (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003020    From 1 To 64 E-value: 4e-35 Score: 138
        GKNPILQCMGNRGFCRSSCKKSEQAYFYCRTFQMCCLQSYVRISLTGVDDNTNWSYEKHWPRIP
  • 2. L05ADEF347    From 20 To 83 E-value: 2e-32 Score: 129
        GKNPTLQCMGNRGFCRPSCKKGEQAYFYCRTYQICCLQSHVRISLTGVEDNTNWSYEKHWPRIP
  • 3. L02A001513    From 1 To 64 E-value: 9e-32 Score: 127
        GKNPTLQCMGNRGFCRPSCKKGEQAYFYCRTYQICCLQSHVRISLTGVEDNTNWSYEKHWPRIP
  • 4. L12A07992|    From 20 To 83 E-value: 4e-29 Score: 118
        GKSPVLHCLSNRGFCRSSCKKDEQPYFYCRNFQTCCLQSYVRISLTGIDEDTNWSYDKHWPKIP
  • 5. L12A08219|    From 21 To 84 E-value: 3e-24 Score: 102
        GKRHILRCMGNSGICRASCKKNEQPYLYCRNYQACCLQSYMRISISGKEENTDWSYEKQWPRLP

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Page D.C.,Menke D.B.,
  •   Title:Sexually dimorphic gene expression in the developing mouse gonad.
  •   Journal:Gene Expr. Patterns, 2002, 2, 359-367  [MEDLINE:22505168]
  •   [2]  Matsui Y.,Yamamoto M.,
  •   Title:Testis-specific expression of a novel mouse defensin-like gene, Tdl.
  •   Journal:Mech. Dev., 2002, 116, 217-221  [MEDLINE:22126610]
  •   [3]  
  •   Title:The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
  •   Journal:Genome Res., 2004, 14, 2121-2127  [PubMed:15489334]
  •   [4]  Zhang G.,Blecha F.,Sang Y.,Cai Y.,Patil A.A.,
  •   Title:Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
  •   Journal:Physiol. Genomics, 2005, 23, 5-17  [PubMed:16033865]
  •   [5]  Frith M.C.,Gough J.,Katayama S.,Kasukawa T.,Carninci P.,
  •   Title:The transcriptional landscape of the mammalian genome.
  •   Journal:Science, 2005, 309, 1559-1563  [PubMed:16141072]
  •   [6]  Goldstein S.,Zody M.C.,Hillier L.W.,Goodstadt L.,Church D.M.,
  •   Title:Lineage-specific biology revealed by a finished genome assembly of the mouse.
  •   Journal:PLoS Biol., 2009, 7, 0-0  [PubMed:19468303]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: