Record in detail


General Info

  • lamp_id:L01A003021
  • Name:DEFI_MYTGA
  • FullName:Defensin MGD-1
  • Source:Mytilus galloprovincialis
  • Mass:4351 Da
  • Sequence Length:38 aa
  • Isoelectric Point:8.78
  • Activity:Antibacterial
  • Sequence
        GFGCPNNYQCHRHCKSIPGRCGGYCGGWHRLRCTCYRC
  • Function:Active against both Gram-positive and Gram-negative bacteria but is not cytotoxic towards human erythrocytes or protozoa.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A02572|    From 1 To 38 E-value: 6e-18 Score: 81.3
        GFGCPNNYQCHRHCKSIPGRCGGYCGGWHRLRCTCYRC
  • 2. L01A003021    From 1 To 38 E-value: 5e-17 Score: 78.2
        GFGCPNNYQCHRHCKSIPGRCGGYCGGWHRLRCTCYRC
  • 3. L03A000031    From 1 To 38 E-value: 5e-17 Score: 78.2
        GFGCPNNYQCHRHCKSIPGRCGGYCGGWHRLRCTCYRC
  • 4. L02A000438    From 1 To 38 E-value: 2e-16 Score: 75.9
        GFGCPNNYQCHRHCKSIPGRCGGYCGGWHRLPCTCYRC
  • 5. L03A000030    From 1 To 37 E-value: 0.000000000000001 Score: 73.2
        GFGCPNDYPCHRHCKSIPGRCGGYCGGWHRLRCTCYR

Structure

  •   Domains
  •   1  Name:Defensin_invertebrate/fungal    Interpro Link:IPR001542
  •   Structures

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Roch P.,Noeel T.,Hubert F.,
  •   Title:
  •   Journal:Eur. J. Biochem., 1996, 240, 815-815  [:]
  •   [2]  Roch P.,Noeel T.,Hubert F.,
  •   Title:A member of the arthropod defensin family from edible Mediterranean mussels (Mytilus galloprovincialis).
  •   Journal:Eur. J. Biochem., 1996, 240, 302-306  [MEDLINE:97025339]
  •   [3]  Roch P.,Hubert F.,Vandenbulcke F.,Mitta G.,
  •   Title:Mussel defensins are synthesised and processed in granulocytes then released into the plasma after bacterial challenge.
  •   Journal:J. Cell Sci., 1999, 112, 4233-4242  [MEDLINE:20033584]
  •   [4]  Sanchez J.F.,Calas B.,Chavanieu A.,Mitta G.,Yang Y.S.,
  •   Title:Solution structure and activity of the synthetic four-disulfide bond Mediterranean mussel defensin (MGD-1).
  •   Journal:Biochemistry, 2000, 39, 14436-14447  [MEDLINE:20541401]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: