Record in detail


General Info

  • lamp_id:L01A003030
  • Name:DEF5_RABIT
  • FullName:Neutrophil antibiotic peptide NP-4
  • Source:Oryctolagus cuniculus
  • Mass:3610.1 Da
  • Sequence Length:33 aa
  • Isoelectric Point:8.91
  • Activity:Antimicrobial
  • Sequence
        VSCTCRRFSCGFGERASGSCTVNGVRHTLCCRR
  • Function:Microbicidal activity.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000281    From 63 To 95 E-value: 0.000000000000009 Score: 70.5
        VSCTCRRFSCGFGERASGSCTVNGVRHTLCCRR
  • 2. L01A003030    From 1 To 33 E-value: 0.0000000000004 Score: 65.1
        VSCTCRRFSCGFGERASGSCTVNGVRHTLCCRR
  • 3. L03A000280    From 63 To 95 E-value: 0.00000000004 Score: 58.5
        VFCTCRGFLCGSGERASGSCTINGVRHTLCCRR
  • 4. L01A003029    From 1 To 33 E-value: 0.0000000005 Score: 54.7
        VFCTCRGFLCGSGERASGSCTINGVRHTLCCRR
  • 5. L05ADEF374    From 65 To 95 E-value: 0.00003 Score: 38.9
        VTCYCRLLSCQFGERLAGSCRSGGVTYPLCC

Structure

  •   Domains
  •   1  Name:Alpha-defensin    Interpro Link:IPR016327
  •   2  Name:Defensin_beta/neutrophil    Interpro Link:IPR006080
  •   3  Name:Defensin_propep    Interpro Link:IPR002366
  •   4  Name:Mammalian_defensins    Interpro Link:IPR006081
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Lehrer R.I.,Harwig S.S.L.,Delange R.J.,Brown D.M.,Selsted M.E.,
  •   Title:Primary structures of six antimicrobial peptides of rabbit peritoneal neutrophils.
  •   Journal:J. Biol. Chem., 1985, 260, 4579-4584  [MEDLINE:85182561]
  •   [2]  Ganz T.,Rayner J.R.,Couto M.,Michaelson D.,
  •   Title:Cationic defensins arise from charge-neutralized propeptides: a mechanism for avoiding leukocyte autocytotoxicity?
  •   Journal:J. Leukoc. Biol., 1992, 51, 634-639  [MEDLINE:92308748]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: