Record in detail


General Info

  • lamp_id:L01A003031
  • Name:DEF2_RABIT
  • FullName:Corticostatin-2
  • Source:Oryctolagus cuniculus
  • Mass:4075.9 Da
  • Sequence Length:34 aa
  • Isoelectric Point:10.28
  • Activity:Antimicrobial
  • Sequence
        GRCVCRKQLLCSYRERRIGDCKIRGVRFPFCCPR
  • Function:Microbicidal activity and inhibits corticotropin (ACTH) stimulated corticosterone production.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003031    From 1 To 34 E-value: 0.00000000000005 Score: 68.2
        GRCVCRKQLLCSYRERRIGDCKIRGVRFPFCCPR
  • 2. L12A09221|    From 65 To 93 E-value: 0.002 Score: 33.1
        CHCRR-LLCLSSEHLSGICTIKGVRYPFCC
  • 3. L03A000279    From 65 To 95 E-value: 0.016 Score: 30
        CACRR-ALCLPRERRAGFCRIRGRIHPLCCRR
  • 4. L03A000280    From 65 To 95 E-value: 0.02 Score: 29.6
        CTCRG-FLCGSGERASGSCTINGVRHTLCCRR
  • 5. L01A000084    From 3 To 33 E-value: 0.029 Score: 29.3
        CACRRAL-CLPRERRAGFCRIRGRIHPLCCRR

Structure

  •   Domains
  •   1  Name:Defensin_beta/neutrophil    Interpro Link:IPR006080
  •   2  Name:Mammalian_defensins    Interpro Link:IPR006081
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Lehrer R.I.,Harwig S.S.L.,Delange R.J.,Brown D.M.,Selsted M.E.,
  •   Title:Primary structures of six antimicrobial peptides of rabbit peritoneal neutrophils.
  •   Journal:J. Biol. Chem., 1985, 260, 4579-4584  [MEDLINE:85182561]
  •   [2]  Solomon S.,Zhu Q.,
  •   Title:Isolation and mode of action of rabbit corticostatic (antiadrenocorticotropin) peptides.
  •   Journal:Endocrinology, 1992, 130, 1413-1423  [MEDLINE:92164536]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: