Record in detail


General Info

  • lamp_id:L01A003032
  • Name:DEFB1_SHEEP
  • FullName:Beta-defensin 1
  • Source:Ovis aries
  • Mass:4803.8 Da
  • Sequence Length:42 aa
  • Isoelectric Point:11.81
  • Activity:Antibacterial
  • Sequence
        QGVRNRLSCHRNKGVCVPSRCPRHMRQIGTCRGPPVKCCRKK
  • Function:Has bactericidal activity (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000266    From 23 To 64 E-value: 2e-19 Score: 86.3
        QGVRNRLSCHRNKGVCVPSRCPRHMRQIGTCRGPPVKCCRKK
  • 2. L01A003032    From 1 To 42 E-value: 9e-19 Score: 84
        QGVRNRLSCHRNKGVCVPSRCPRHMRQIGTCRGPPVKCCRKK
  • 3. L02A000268    From 1 To 38 E-value: 1e-16 Score: 76.6
        NRLSCHRNKGVCVPSRCPRHMRQIGTCRGPPVKCCRKK
  • 4. L12A04736|    From 22 To 63 E-value: 0.000000000000007 Score: 70.9
        QGIRSRRSCHRNKGVCALTRCPRNMRQIGTCFGPPVKCCRKK
  • 5. L03A000264    From 23 To 64 E-value: 0.000000000000007 Score: 70.9
        QGIRSRRSCHRNKGVCALTRCPRNMRQIGTCFGPPVKCCRKK

Structure

  •   Domains
  •   1  Name:Defensin_beta-typ    Interpro Link:IPR001855
  •   2  Name:Defensin_beta/neutrophil    Interpro Link:IPR006080
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Diamond G.,Mahoney M.M.,Brezinski-Caliguri D.J.,Huttner K.M.,
  •   Title:Antimicrobial peptide expression is developmentally regulated in the ovine gastrointestinal tract.
  •   Journal:J. Nutr., 1998, 128, 297-299  [MEDLINE:98138497]
  •   [2]  Broad T.E.,Burkin H.R.,Lambeth M.R.,Huttner K.M.,
  •   Title:Localization and genomic organization of sheep antimicrobial peptides genes.
  •   Journal:Gene, 1998, 206, 85-91  [MEDLINE:98121317]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: