Record in detail


General Info

  • lamp_id:L01A003036
  • Name:D103A_PANTR
  • FullName:Beta-defensin 103A
  • Source:Pan troglodytes
  • Mass:5175.2 Da
  • Sequence Length:45 aa
  • Isoelectric Point:10.63
  • Activity:Antibacterial
  • Sequence
        GIINTLQKYYCRVRGGRCAVLTCLPKEEQIGKCSTRGRKCCRRKK
  • Function:Exhibits antimicrobial activity against Gram-positive and Gram-negative bacteria (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003036    From 1 To 45 E-value: 2e-20 Score: 89.4
        GIINTLQKYYCRVRGGRCAVLTCLPKEEQIGKCSTRGRKCCRRKK
  • 2. L03A000252    From 23 To 67 E-value: 3e-20 Score: 88.6
        GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK
  • 3. L03A000247    From 23 To 67 E-value: 3e-20 Score: 88.6
        GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK
  • 4. L01A000701    From 1 To 45 E-value: 5e-20 Score: 88.2
        GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK
  • 5. L03A000245    From 23 To 67 E-value: 7e-20 Score: 87.4
        GIINTLQKYYCRVRGGRCALLSCLPKEEQIGKCSTRGRKCCRRKK

Structure

  •   Domains
  •   1  Name:Defensin_beta-typ    Interpro Link:IPR001855
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Zhang G.,Blecha F.,Sang Y.,Cai Y.,Patil A.A.,
  •   Title:Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
  •   Journal:Physiol. Genomics, 2005, 23, 5-17  [PubMed:16033865]
  •   [2]  Eastwood H.,Kilanowski F.M.,Gautier P.,Maxwell A.,Semple C.A.M.,
  •   Title:The complexity of selection at the major primate beta-defensin locus.
  •   Journal:BMC Evol. Biol., 2005, 5, 32-32  [PubMed:15904491]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: