Record in detail


General Info

  • lamp_id:L01A003049
  • Name:PLECT_PSENR
  • FullName:Plectasin
  • Source:Pseudoplectania nigrella
  • Mass:4408 Da
  • Sequence Length:40 aa
  • Isoelectric Point:7.77
  • Activity:Antibacterial
  • Sequence
        GFGCNGPWDEDDMQCHNHCKSIKGYKGGYCAKGGFVCKCY
  • Function:Has a potent antibiotic activity against several species of Gram-positive bacteria. Especially active against numerous clinical isolates of S.pneumoniae, including all 90 different serotypes and isolates resistant to clinically used antibiotics. Shows considerable selectivity for bacteria over mammalian cells in vitro.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A08934|    From 56 To 95 E-value: 3e-20 Score: 88.6
        GFGCNGPWDEDDMQCHNHCKSIKGYKGGYCAKGGFVCKCY
  • 2. L01A003049    From 1 To 40 E-value: 9e-19 Score: 84
        GFGCNGPWDEDDMQCHNHCKSIKGYKGGYCAKGGFVCKCY
  • 3. L11A013058    From 1 To 40 E-value: 7e-18 Score: 80.9
        GFGCNGPWDEDDMKCHNHCKSIKGYKGGYCAKAGFVCKCY
  • 4. L13A011186    From 3 To 42 E-value: 1e-17 Score: 80.5
        GFGCNGPWNEDDLRCHNHCKSIKGYKGGYCAKGGFVCKCY
  • 5. L11A004535    From 1 To 40 E-value: 1e-17 Score: 80.1
        GFGCNGPWNEDDLRCHNHCKSIKGYKGGYCAKGGFVCKCY

Structure

  •   Domains
  •   1  Name:Defensin_invertebrate/fungal    Interpro Link:IPR001542
  •   Structures

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Soenksen C.P.,Hansen M.T.,Schnorr K.M.,Fischer R.L.,Mygind P.H.,
  •   Title:Plectasin is a peptide antibiotic with therapeutic potential from a saprophytic fungus.
  •   Journal:Nature, 2005, 437, 975-980  [PubMed:16222292]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: