Record in detail


General Info

  • lamp_id:L01A003051
  • Name:DEFB1_RAT
  • FullName:Beta-defensin 1
  • Source:Rattus norvegicus
  • Mass:4132.7 Da
  • Sequence Length:37 aa
  • Isoelectric Point:8.63
  • Activity:Antibacterial
  • Sequence
        DQYRCLQNGGFCLRSSCPSHTKLQGTCKPDKPNCCRS
  • Function:Has bactericidal activity (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000174    From 33 To 69 E-value: 7e-18 Score: 80.9
        DQYRCLQNGGFCLRSSCPSHTKLQGTCKPDKPNCCRS
  • 2. L01A003051    From 1 To 37 E-value: 6e-17 Score: 77.8
        DQYRCLQNGGFCLRSSCPSHTKLQGTCKPDKPNCCRS
  • 3. L01A001449    From 33 To 69 E-value: 0.000000000000001 Score: 73.2
        DQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS
  • 4. L01A000610    From 1 To 37 E-value: 0.000000000000005 Score: 71.2
        DQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS
  • 5. L13A017404    From 1 To 36 E-value: 0.00000008 Score: 47.4
        DHYLCVKNEGICLYSSCPSYTKIEGTCYGGKAKCCK

Structure

  •   Domains
  •   1  Name:Defensin_beta-typ    Interpro Link:IPR001855
  •   2  Name:Defensin_beta/neutrophil    Interpro Link:IPR006080
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Mallampali R.K.,Nishimura D.,Barahmand-Pour F.,Mills J.N.,Jia H.P.,
  •   Title:Molecular cloning and characterization of rat genes encoding homologues of human beta-defensins.
  •   Journal:Infect. Immun., 1999, 67, 4827-4833  [MEDLINE:99386883]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: