Record in detail
General Info
- lamp_id:L01A003052
- Name:DEFB1_SAGOE
- FullName:Beta-defensin 1
- Source:Saguinus oedipus
- Mass:3848.5 Da
- Sequence Length:36 aa
- Isoelectric Point:8.6
- Activity:Antibacterial
- Sequence
DHYNCVKGGGQCLYSACPIYTKVQGTCYGGKAKCCK - Function:Has bactericidal activity (By similarity).
Cross-Linking
- Cross-linking
- 1 Database:CAMP CAMPSQ1640
- 2 Database:dbAMP dbAMP_01053
- 3 Database:DRAMP DRAMP03161
- 4 Database:Uniprot Q95M66
- 5 Database:DEF DEF121
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L03A000290 From 33 To 68 E-value: 2e-16 Score: 75.9
DHYNCVKGGGQCLYSACPIYTKVQGTCYGGKAKCCK - 2. L01A003052 From 1 To 36 E-value: 0.000000000000001 Score: 73.6
DHYNCVKGGGQCLYSACPIYTKVQGTCYGGKAKCCK - 3. L03A000291 From 33 To 68 E-value: 0.000000000000006 Score: 71.2
DHYNCVSSGGQCLYSACPIFTKIQGTCYGGKAKCCK - 4. L03A000296 From 33 To 68 E-value: 0.000000000000007 Score: 70.9
DHYNCVRSGGQCLYSACPIYTKIQGTCYHGKAKCCK - 5. L03A000294 From 33 To 68 E-value: 0.000000000000008 Score: 70.9
DHYNCVRSGGQCLYSACPIYTKIQGTCYQGKAKCCK
Structure
- Domains
- 1 Name:Defensin_beta-typ Interpro Link:IPR001855
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Spano A.,Cervella P.,Zuccon D.,Boniotto M.,Del Pero M.,
- Title:Beta-defensin 1 gene variability among non-human primates.
- Journal:Immunogenetics, 2002, 53, 907-913 [MEDLINE:21850507]
Comments
- Comments
No comments found on LAMP database