Record in detail


General Info

  • lamp_id:L01A003054
  • Name:DEF2_VIGUN
  • FullName:Defensin-like protein 2
  • Source:Vigna unguiculata
  • Mass:5242.2 Da
  • Sequence Length:46 aa
  • Isoelectric Point:8.98
  • Activity:Antibacterial
  • Sequence
        KTCMTKKEGWGRCLIDTTCAHSCRKYGYMGGKCQGITRRCYCLLNC
  • Function:Has antibacterial activity against the Gram-positive bacterium S.aureus and the Gram-negative bacteria E.coli and P.syringae. Does not have antibacterial activity against the phytopathogenic bacteria R.solanacearum, Rhataybacter sp and Erwinia sp. Does not inhibit trypsin, chymotrypsin or alpha-amylases.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003054    From 1 To 46 E-value: 8e-22 Score: 94
        KTCMTKKEGWGRCLIDTTCAHSCRKYGYMGGKCQGITRRCYCLLNC
  • 2. L11A005877    From 1 To 46 E-value: 4e-17 Score: 78.6
        KTCMTKKEGWGRCLIDTTCAHSCRKQGYKGGNCKGMRRTCYCLLDC
  • 3. L03A000114    From 28 To 73 E-value: 8e-17 Score: 77.4
        RTCMIKKEGWGKCLIDTTCAHSCKNRGYIGGNCKGMTRTCYCLVNC
  • 4. L01A002676    From 1 To 46 E-value: 2e-16 Score: 75.9
        RTCMIKKEGWGKCLIDTTCAHSCKNRGYIGGNCKGMTRTCYCLVNC
  • 5. L02A000989    From 1 To 46 E-value: 2e-16 Score: 75.9
        RTCMIKKEGWGKCLIDTTCAHSCKNRGYIGGDCKGMTRTCYCLVNC

Structure

  •   Domains
  •   1  Name:Gamma-thionin    Interpro Link:IPR008176
  •   2  Name:Knot1    Interpro Link:IPR003614
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Staphylococcus aureus ATTC 25923  MIC:  128 μg/ml  (24.4172 μM)  
  •   2  Target:  Escherichia coli ATTC 25922  MIC:  64 μg/ml  (12.2086 μM)  
  •   3  Target:  Pseudomonas syringae  MIC:  42 μg/ml  (8.0119 μM)  

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Prates M.V.,Mendes P.A.M.,Leite J.R.,Murad A.M.,Franco O.L.,
  •   Title:Identification of a cowpea gamma-thionin with bactericidal activity.
  •   Journal:FEBS J., 2006, 273, 3489-3497  [PubMed:16824043]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: