Record in detail


General Info

  • lamp_id:L01A003055
  • Name:DEF1_TRIKH
  • FullName:Defensin Tk-AMP-D1
  • Source:Triticum kiharae
  • Mass:5744.3 Da
  • Sequence Length:49 aa
  • Isoelectric Point:7.99
  • Activity:Antimicrobial
  • Sequence
        RTCQSQSHKFKGACFSDTNCDSVCRTENFPRGQCNQHHVERKCYCERDC
  • Function:Has weak antifungal activity against F.graminearum and F.verticillioides below 30 ug/ml, but not against A.consortiale B.cinerea, H.sativum, F.culmorum, C.graminicola and D.maydis.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003055    From 1 To 49 E-value: 4e-24 Score: 101
        RTCQSQSHKFKGACFSDTNCDSVCRTENFPRGQCNQHHVERKCYCERDC
  • 2. L01A003063    From 1 To 49 E-value: 2e-23 Score: 99.4
        RTCQSQSHKFKGACFSDTNCASVCRTENFPRGQCNQHHVERKCYCERDC
  • 3. L01A003057    From 1 To 49 E-value: 3e-21 Score: 92
        RTCESQSHKFKGPCFSDSNCATVCRTENFPRGQCNQHHVERKCYCERSC
  • 4. L03A000105    From 32 To 80 E-value: 0.00000000000009 Score: 67.4
        RHCLSQSHRFKGMCVSSNNCANVCRTESFPDGECKSHGLERKCFCKKVC
  • 5. L12A10450|    From 1 To 49 E-value: 0.0000000000006 Score: 64.3
        RHCLSQSHRFKGMCVSSNNCANVCRTESFPDGECKSHGLERKCFCKKVC

Structure

  •   Domains
  •   1  Name:G_Purothionin    Interpro Link:IPR008177
  •   2  Name:Gamma-thionin    Interpro Link:IPR008176
  •   3  Name:Knot1    Interpro Link:IPR003614
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Pukhalsky V.A.,Odintsova M.S.,Musolyamov A.K.,Egorov T.A.,Odintsova T.I.,
  •   Title:Seed defensins from T. kiharae and related species: Genome localization of defensin-encoding genes.
  •   Journal:Biochimie, 2007, 89, 605-612  [PubMed:17321030]
  •   [2]  Yalpani N.,Musolyamov A.K.,Baranov Y.,Rogozhin E.A.,Odintsova T.I.,
  •   Title:Seed defensins of barnyard grass Echinochloa crusgalli (L.) Beauv.
  •   Journal:Biochimie, 2008, 90, 1667-1673  [PubMed:18625284]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: