Record in detail


General Info

  • lamp_id:L01A003063
  • Name:DEF12_TRIMO
  • FullName:Defensin Tm-AMP-D1.2
  • Source:Triticum monococcum
  • Mass:5700.3 Da
  • Sequence Length:49 aa
  • Isoelectric Point:8.22
  • Activity:Antimicrobial
  • Sequence
        RTCQSQSHKFKGACFSDTNCASVCRTENFPRGQCNQHHVERKCYCERDC
  • Function:Plant defense peptide (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003063    From 1 To 49 E-value: 4e-24 Score: 101
        RTCQSQSHKFKGACFSDTNCASVCRTENFPRGQCNQHHVERKCYCERDC
  • 2. L01A003055    From 1 To 49 E-value: 2e-23 Score: 99.4
        RTCQSQSHKFKGACFSDTNCDSVCRTENFPRGQCNQHHVERKCYCERDC
  • 3. L01A003057    From 1 To 49 E-value: 6e-22 Score: 94.4
        RTCESQSHKFKGPCFSDSNCATVCRTENFPRGQCNQHHVERKCYCERSC
  • 4. L03A000105    From 32 To 80 E-value: 0.00000000000002 Score: 69.3
        RHCLSQSHRFKGMCVSSNNCANVCRTESFPDGECKSHGLERKCFCKKVC
  • 5. L12A10450|    From 1 To 49 E-value: 0.0000000000001 Score: 66.6
        RHCLSQSHRFKGMCVSSNNCANVCRTESFPDGECKSHGLERKCFCKKVC

Structure

  •   Domains
  •   1  Name:G_Purothionin    Interpro Link:IPR008177
  •   2  Name:Gamma-thionin    Interpro Link:IPR008176
  •   3  Name:Knot1    Interpro Link:IPR003614
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Pukhalsky V.A.,Odintsova M.S.,Musolyamov A.K.,Egorov T.A.,Odintsova T.I.,
  •   Title:Seed defensins from T. kiharae and related species: Genome localization of defensin-encoding genes.
  •   Journal:Biochimie, 2007, 89, 605-612  [PubMed:17321030]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: