Record in detail


General Info

  • lamp_id:L01A003065
  • Name:DEF_PETIN
  • FullName:Defensin-like protein
  • Source:Petunia integrifolia
  • Mass:5376 Da
  • Sequence Length:47 aa
  • Isoelectric Point:8.61
  • Activity:Antimicrobial
  • Sequence
        RTCESQSHRFHGTCVRESNCASVCQTEGFIGGNCRAFRRRCFCTRNC
  • Function:May be involved in the defense of the pistil against pathogen infection.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003065    From 1 To 47 E-value: 2e-21 Score: 93.2
        RTCESQSHRFHGTCVRESNCASVCQTEGFIGGNCRAFRRRCFCTRNC
  • 2. L02A001330    From 1 To 47 E-value: 6e-18 Score: 81.3
        RTCESQSHRFKGTCVRQSNCAAVCQTEGFHGGNCRGFRRRCFCTKHC
  • 3. L03A000162    From 31 To 77 E-value: 1e-17 Score: 80.5
        RTCESQSHRFKGTCVSASNCANVCHNEGFVGGNCRGFRRRCFCTRHC
  • 4. L05ADEF308    From 31 To 77 E-value: 5e-17 Score: 78.2
        RTCESQSHKFQGTCLRESNCANVCQTEGFQGGVCRGVRRRCFCTRLC
  • 5. L12A06235|    From 31 To 77 E-value: 7e-17 Score: 77.8
        RTCESQSHRFKGLCFSKSNCASVCHTEGFYGGHCRGFRRRCFCTRHC

Structure

  •   Domains
  •   1  Name:G_Purothionin    Interpro Link:IPR008177
  •   2  Name:Gamma-thionin    Interpro Link:IPR008176
  •   3  Name:Knot1    Interpro Link:IPR003614
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Kao T.H.,Singh A.,Karunanandaa B.,
  •   Title:Characterization of a predominantly pistil-expressed gene encoding a gamma-thionin-like protein of Petunia inflata.
  •   Journal:Plant Mol. Biol., 1994, 26, 459-464  [MEDLINE:95036017]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: