Record in detail


General Info

  • lamp_id:L01A003068
  • Name:DEF4_RAPSA
  • FullName:Defensin-like protein 4
  • Source:Raphanus sativus
  • Mass:5400.1 Da
  • Sequence Length:48 aa
  • Isoelectric Point:8.29
  • Activity:Antifungal
  • Sequence
        QKLCERSSGTWSGVCGNNNACKNQCINLEGARHGSCNYIFPYHRCICY
  • Function:Possesses antifungal activity sensitive to inorganic cations (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000090    From 30 To 77 E-value: 9e-25 Score: 103
        QKLCEKSSGTWSGVCGNNNACKNQCINLEGARHGSCNYIFPYHRCICY
  • 2. L01A003068    From 1 To 48 E-value: 7e-24 Score: 100
        QKLCERSSGTWSGVCGNNNACKNQCINLEGARHGSCNYIFPYHRCICY
  • 3. L01A002031    From 1 To 48 E-value: 9e-24 Score: 100
        QKLCERSSGTWSGVCGNNNACKNQCINLEGARHGSCNYIFPYHRCICY
  • 4. L06AT00032    From 1 To 48 E-value: 2e-23 Score: 99.8
        QKLCEKSSGTWSGVCGNNNACKNQCINLEGARHGSCNYIFPYHRCICY
  • 5. L11A001965    From 2 To 48 E-value: 4e-23 Score: 98.6
        KLCERSSGTWSGVCGNNNACKNQCINLEGARHGSCNYIFPYHRCICY

Structure

  •   Domains
  •   1  Name:Gamma-thionin    Interpro Link:IPR008176
  •   2  Name:Knot1    Interpro Link:IPR003614
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  A. brassicola  MIC:  5 μg/ml  (0.925909 μM)  
  •   2  Target:  Botrytis cinerea  MIC:  9 μg/ml  (1.66664 μM)  
  •   3  Target:  F. culmorum  MIC:  11 μg/ml  (2.037 μM)  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: