Record in detail


General Info

  • lamp_id:L01A003071
  • Name:THNB_PHOLI
  • FullName:Ligatoxin-B
  • Source:Phoradendron liga
  • Mass:4798.3 Da
  • Sequence Length:46 aa
  • Isoelectric Point:8.63
  • Activity:Antimicrobial, ,Anticancer
  • Sequence
        KSCCPSTTARNIYNTCRLTGASRSVCASLSGCKIISGSTCDSGWNH
  • Function:Thionins are small plant proteins which are toxic to animal cells. They seem to exert their toxic effect at the level of the cell membrane. Their precise function is not known.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003071    From 1 To 46 E-value: 3e-21 Score: 92
        KSCCPSTTARNIYNTCRLTGASRSVCASLSGCKIISGSTCDSGWNH
  • 2. L06AT00070    From 1 To 46 E-value: 2e-19 Score: 85.9
        KSCCPSTTARNIYNTCRLTGTSRPTCASLSGCKIISGSTCBSGWBH
  • 3. L02A000237    From 1 To 46 E-value: 6e-18 Score: 81.3
        KSCCPTTTARNIYNTCRFGGGSRPVCAKLSGCKIISGTKCDSGWNH
  • 4. L13A019293    From 1 To 44 E-value: 0.000000000000005 Score: 71.2
        KSCCPSTTGRNIYNTCRLTGSSRETCAKLSGCKIISASTCPSNY
  • 5. L02A001277    From 1 To 44 E-value: 0.00000000000001 Score: 70.5
        KSCCPNTTGRNIYNACRLTGAPRPTCAKLSGCKIISGSTCPSDY

Structure

  •   Domains
  •   1  Name:Thionin    Interpro Link:IPR001010
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  human lymphoma cell line U-937-GTB  MIC:  8.64 μg/ml  (1.80064 μM)  
  •   2  Target:  renal adenocarcinoma cell line ACHN  MIC:  15.35 μg/ml  (3.19905 μM)  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Thunberg E.,Larsson R.,Lindholm P.,Gullbo J.,Li S.S.,
  •   Title:Ligatoxin B, a new cytotoxic protein with a novel helix-turn-helix DNA-binding domain from the mistletoe Phoradendron liga.
  •   Journal:Biochem. J., 2002, 366, 405-413  [MEDLINE:22176324]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: