Record in detail


General Info

  • lamp_id:L01A003072
  • Name:AMP1_ALLCE
  • FullName:Antimicrobial protein Ace-AMP1
  • Source:Allium cepa
  • Mass:10844.7 Da
  • Sequence Length:93 aa
  • Isoelectric Point:12.27
  • Activity:Antibacterial, Antifungal
  • Sequence
        QNICPRVNRIVTPCVAYGLGRAPIAPCCRALNDLRFVNTRNLRRAACRCLVGVVNRNPGLRRNPRFQNIPRDCRNTFVRPFWWRPRIQCGRIN
  • Function:Antifungal and antibacterial activity against the Gram-positive bacteria B.megaterium and S.lutea.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003072    From 1 To 93 E-value: 0 Score: 179
        QNICPRVNRIVTPCVAYGLGRAPIAPCCRALNDLRFVNTRNLRRAACRCLVGVVNRNPGLRRNPRFQNIPRDCRNTFVRPFWWRPRIQCGRIN
  • 2. L06AT00142    From 3 To 93 E-value: 0.0000002 Score: 45.8
        TCGQVSSAIAPCLSYARGTGSGPSASCCSGVRNLKSAASTAADRRAACNCLKNAARGVSGLNAG-NAASIPSKCGVSI--PYTISTSTDCSRVN
  • 3. L06AT00136    From 4 To 90 E-value: 0.0000009 Score: 44.3
        CGQVSSALTPCVAYAKGSGTSPSGACCSGVRKLAGLARSTADKQATCRCLKSVAG---GLNPN-KAAGIPSKCGVSV--PYTISASVDCSKIH
  • 4. L06AT00140    From 4 To 93 E-value: 0.000001 Score: 43.5
        CGQVASAIAPCISYARGQGSAPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAG-NAASIPSKCGVSI--PYTISTSTDCSRVN
  • 5. L06AT00141    From 4 To 93 E-value: 0.000001 Score: 43.5
        CGQVASAIAPCISYARGQGSGPSAGCCSGVKSLNNAARTTADRRAACNCLKNAAAGVSGLNAG-NAASIPSKCGVSI--PYTISTSTDCSRVN

Structure

  •   Domains
  •   1  Name:Bifunc_inhib/LTP/seed_store    Interpro Link:IPR016140
  •   2  Name:Lipid_transfer_prot_hlx-dom    Interpro Link:IPR013770
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  A. brassicola  MIC:  2.5 μg/ml  (0.230527 μM)  
  •   2  Target:  A. pisi  MIC:  1 μg/ml  (0.0922109 μM)  
  •   3  Target:  B. cinerea  MIC:  3 μg/ml  (0.276633 μM)  
  •   4  Target:  C. lindemuthianum  MIC:  1.5 μg/ml  (0.138316 μM)  
  •   5  Target:  F. culmorum  MIC:  6 μg/ml  (0.553266 μM)  
  •   6  Target:  F. oxysporum fsp. Pisi  MIC:  3.5 μg/ml  (0.322738 μM)  
  •   7  Target:  F. oxysporum fsp. Lycopersici  MIC:  3 μg/ml  (0.276633 μM)  
  •   8  Target:  N. haematococca  MIC:  3.5 μg/ml  (0.322738 μM)  
  •   9  Target:  P. betae  MIC:  1.5 μg/ml  (0.138316 μM)  
  •   10  Target:  P. tritici-repentis  MIC:  3 μg/ml  (0.276633 μM)  
  •   11  Target:  P. oryzae  MIC:  3 μg/ml  (0.276633 μM)  
  •   12  Target:  V. dahliae  MIC:  0.25 μg/ml  (0.0230527 μM)  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Goderis I.J.,Eggermont K.,Hendriks M.,Thevissen K.,Cammue B.P.A.,
  •   Title:A potent antimicrobial protein from onion seeds showing sequence homology to plant lipid transfer proteins.
  •   Journal:Plant Physiol., 1995, 109, 445-455  [MEDLINE:96030247]
  •   [2]  Ptak M.,Acland D.P.,Marion D.,Broekaert W.F.,Tassin S.,
  •   Title:Solution structure of Ace-AMP1, a potent antimicrobial protein extracted from onion seeds. Structural analogies with plant nonspecific lipid transfer proteins.
  •   Journal:Biochemistry, 1998, 37, 3623-3637  [MEDLINE:98191322]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: